DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act88F and Arp53D

DIOPT Version :10

Sequence 1:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster


Alignment Length:107 Identity:21/107 - (19%)
Similarity:42/107 - (39%) Gaps:35/107 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FIPSYSKLL-DNYDGAKHAKVWRLHNVTEAYDT----------KLGTLANVMENSH--------- 104
            |.|::.::: :|||  .::.:..:..|..|..|          |||    |..:||         
  Fly   662 FAPTFVRMVRENYD--PYSNILTVEFVIRANPTPTLTWYKGIIKLG----VYPDSHMRISQHFDE 720

  Fly   105 --------IGFIDRLTFDADFWIDMCADLLGKLPEMQHIIDY 138
                    :.|.|....|...:|.:..:.:|: ...:|::|:
  Fly   721 TAEHTIASLVFYDPSYTDNGEYICIATNTVGE-ATCKHVVDF 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act88FNP_524367.1 ASKHA_NBD_actin 8..371 CDD:466823 21/107 (20%)
Arp53DNP_477037.2 ASKHA_ATPase-like 47..406 CDD:483947
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.