DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act88F and Arp10

DIOPT Version :9

Sequence 1:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster


Alignment Length:386 Identity:85/386 - (22%)
Similarity:159/386 - (41%) Gaps:66/386 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIE 73
            :|:|.|:...|.|||.:..||.:.|:.|       ||...|.:          ||          
  Fly    14 IVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIR----------KR---------- 51

  Fly    74 HGIITNWDDMEKIWHH-------TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN-S 130
               :.::|..|:::..       .|:..|.|:|:|...:|.|........||.:.:::|..|: |
  Fly    52 ---LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVS 113

  Fly   131 PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILT 195
            ..::|.:. :::|......|.:|:|.|...:..:|::.|..:..|.......|..:...:.:.|.
  Fly   114 SVLFVPVH-LIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLV 177

  Fly   196 ERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNE------ 254
            |.|...:...| .::.|||.:.|:|.   ..|.|.|.|:....:....||...|...|:      
  Fly   178 ESGVKESLLTE-SVLEDIKVRTCFVT---TMERAKARANGDENQPTPAPDVDYIVSDNDAVIQVP 238

  Fly   255 ---RFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVLSGGTTMYPGIADRMQK 316
               |....|.:|:.|   .|...:...:..||:.|.:|:|:.|..:..|.||.:|..|:..|:::
  Fly   239 GLLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQ 300

  Fly   317 EITALAP----------STIKIKII-APPERKYSVWIGGSILASLSTFQQMWISKQEYDES 366
            |:..|..          ..::.|.. |..::.::.|:||::..:....|...:.|:.|.:|
  Fly   301 ELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 85/386 (22%)
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 80/363 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 85/386 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.