DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act88F and Actr10

DIOPT Version :9

Sequence 1:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001009602.1 Gene:Actr10 / 299121 RGDID:1306515 Length:417 Species:Rattus norvegicus


Alignment Length:394 Identity:108/394 - (27%)
Similarity:183/394 - (46%) Gaps:60/394 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPI 72
            |:|||.|....|.||||:..||.:.||::.|       .||             .:.|..::|.|
  Rat    15 AVVIDLGEAFTKCGFAGETGPRCIIPSVIKR-------AGM-------------SKPIKVVQYNI 59

  Fly    73 EHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAI 137
            ....:.::  :::..|..::..|.|.|.:..|::.|:.|.|...||.:|:::|:.|..|::.:|.
  Rat    60 NTEELYSY--LKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAP 122

  Fly   138 QAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTE------ 196
            ..:::|...|..:.:|||.|...|..:|||||..:.:....|.|.|:.|...|...|.|      
  Rat   123 SHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDT 187

  Fly   197 ---RGYSFTT---TAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELP----------D 245
               :|.|..:   :....::.|||.:.|:|: |.::.:...||..:::.:.|.|          |
  Rat   188 GAAKGQSLPSVMGSVPESVLEDIKVRTCFVS-DLQRGLQIQAAKFNIDGNNERPSPPPNVDYPLD 251

  Fly   246 GQVI--TIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVLSGGTTMYP 308
            |:.|  .:|:.|....|.||:..   .|...:...:.:|:::|.||.||.|..|.|:.|||:|.|
  Rat   252 GEKILHVLGSIRDSVVEILFEQD---NEEKSVATLILDSLLQCPVDTRKQLAENLVIIGGTSMLP 313

  Fly   309 GIADRMQKEITALAP--------STIKIKIIAPPERKYSV-WIGGSILASL-STFQQMWISKQEY 363
            |...|:..||..|..        .|...:|..||.:...| |:||::..:| .......|||:.|
  Rat   314 GFLHRLLAEIRYLVEKPKYKKTLGTKNFRIHTPPAKANCVAWLGGAVFGALQDILGSRSISKEYY 378

  Fly   364 DESG 367
            :::|
  Rat   379 NQTG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 108/394 (27%)
Actr10NP_001009602.1 NBD_sugar-kinase_HSP70_actin 13..364 CDD:418402 102/374 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.