DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act88F and Actl9b

DIOPT Version :9

Sequence 1:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001013915.1 Gene:Actl9b / 292516 RGDID:1359476 Length:411 Species:Rattus norvegicus


Alignment Length:371 Identity:156/371 - (42%)
Similarity:233/371 - (62%) Gaps:11/371 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVIDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPI 72
            :|||.|:|:||.||||...|..:..:||| :|:.:..| ...:.:.::| ||...|..|||.:|:
  Rat    47 VVIDMGTGICKMGFAGQTRPTYIVRNIVGCQPKRRTTM-EQPKMEMFIG-EAAHARPELTLMHPV 109

  Fly    73 EHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAI 137
            .:||:.:|:..|.||.|...|:||:..::||:|.|:.|.||.:||||:.::.||:.:|||:|||.
  Rat   110 RNGIVVDWEAAEFIWRHILENDLRLDTQDHPLLFTDPPFNPASNREKLVEVAFESLHSPAIYVAS 174

  Fly   138 QAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLM-KILTERGYSF 201
            |:|||:||:||..|:|:|:|.|||:|||:::|:.||..|.|:||||..||.:|. |||..   ||
  Rat   175 QSVLSVYANGRVNGLVVDTGHGVSYTVPVFQGYNLPSGIQRMDLAGHYLTKFLAEKILRS---SF 236

  Fly   202 TTTAE-REIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQ- 264
            ....| .:.:.:||::.|||||||::|.  ........:..:|||||:||:|.|.|:|||.||. 
  Rat   237 AVKKEDMDTMENIKQQYCYVALDFQKEQ--GRPDEKFRRCLKLPDGQMITVGKELFQCPELLFHP 299

  Fly   265 PSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVLSGGTTMYPGIADRMQKEITALAPSTIKIK 329
            |...|..|.|:...|.:|:.....::|.|:..|.:|.||::::.|...|.:.|:.........:.
  Rat   300 PDTSGPSSLGLPSMVEHSLSTVPQELRADMEQNVLLCGGSSLFTGFEGRFKTELLRRLGPEAHVV 364

  Fly   330 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKC 375
            ::|...|..||||||||||||..||..|:.:::|:|.||.||.|||
  Rat   365 VVAQANRNLSVWIGGSILASLCAFQTRWVLREQYEEHGPDIVLRKC 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 156/371 (42%)
Actl9bNP_001013915.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
NBD_sugar-kinase_HSP70_actin 45..410 CDD:302596 154/369 (42%)
Actin 47..411 CDD:278451 156/371 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.