DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act88F and arp9

DIOPT Version :9

Sequence 1:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_594356.1 Gene:arp9 / 2541540 PomBaseID:SPAC1071.06 Length:523 Species:Schizosaccharomyces pombe


Alignment Length:416 Identity:96/416 - (23%)
Similarity:156/416 - (37%) Gaps:118/416 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PIEHGIITNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMTQIMFETFNSP 131
            ||:.|.:.:|:.::..|.| .|:.|...|.:    :||.|.........:||..||..||....|
pombe   113 PIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELATQFFFEECQVP 176

  Fly   132 AMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTE 196
            ...:|.:.::.|||.|...|:|:|.|...:...||.:|..:..|..:|.|.||.:|.:|..:|.|
pombe   177 GFTIAYEPLMGLYAIGILHGLVIDIGYEKTDITPILDGQIIFTATQQLPLGGRYMTQHLQNLLRE 241

  Fly   197 RGYSFTTTAEREIVRDIKE---------KLCYVALDFEQEMA----TAAASTS------------ 236
            ...:..::.:.....||.|         ::..|..| ||:.|    .|..||:            
pombe   242 SLPTLKSSGQYVSKEDITELFAEQVKCSEIAQVVRD-EQDTAKDPVKALTSTNNVEEEDPAEDIG 305

  Fly   237 ----------------------LEKSYELPDG-----QVITI--------GNERFRCPEALF-QP 265
                                  .||. |.||.     |.|.|        |.|||:..|.:| :|
pombe   306 KIIASGQTRAYLAQKEREKNGESEKD-EKPDNTDVEFQTIAIEPLGDCIVGRERFKICEPIFHRP 369

  Fly   266 SFLGMESCGIHETVYNSIMK--CDVDIRKDLYANSVLSGGTTMYPGIADRMQKEI---------- 318
            |   .|:..:.|.:|.:|..  .:...|.||:.|.::.|..:...|..:.:.:::          
pombe   370 S---NETVSLPEAIYITIKNYAANYKRRNDLWENIIVLGCGSRIRGFRECLIQQLQFKYQLSGSL 431

  Fly   319 ---------------TALAPSTIKIKI----IAP---PERKYS----------VWIGGSILASLS 351
                           |.:.|:.....|    |.|   |..|..          .::||||:|..|
pombe   432 EPYYAAQGTDSILGMTTMPPTPYPALINPCKILPDYFPSWKPDAGTNAMFEELAFLGGSIVAKTS 496

  Fly   352 ---TFQQMWISKQEYDESGPGIVHRK 374
               :....:::.:||.:.||..:|.|
pombe   497 FNESVSSHYVTLEEYAQHGPTAIHTK 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 96/416 (23%)
arp9NP_594356.1 COG5277 26..523 CDD:227602 96/416 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.