DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act88F and Actl10

DIOPT Version :9

Sequence 1:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_003749645.1 Gene:Actl10 / 100911682 RGDID:6491130 Length:334 Species:Rattus norvegicus


Alignment Length:317 Identity:110/317 - (34%)
Similarity:179/317 - (56%) Gaps:18/317 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMY 134
            :||:||::.:||.:|.:|.......|::.||:.|||::::|..|...|||:.:::||....||.:
  Rat    25 HPIKHGVVVDWDALEGLWERLMVGGLQIHPEQWPVLVSDSPSAPPEGREKVAELLFEALTVPACH 89

  Fly   135 VAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGY 199
            :|..|:|:|.:.|..:|:.:::|.||.|..|||.|.:...|..||::||..|:.|...:|.....
  Rat    90 MASTALLALCSVGAFSGLAVEAGAGVCHATPIYAGHSWHKATFRLNVAGSTLSRYFRDLLVASCP 154

  Fly   200 SFTTTA-EREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALF 263
            .....| .|:.|..:|::.|||:|||:.::...|...  ...:.|..|..:.:|:|||||||.:|
  Rat   155 DLQLHALPRKTVTQLKKRCCYVSLDFQGDICDPARHQ--RACFCLGKGCYVRLGSERFRCPEPIF 217

  Fly   264 QPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVLSGGTTMYPGIADRMQKEI---------T 319
            |||.||....|:....:.::.|....:|..|....||:||:|::||..:||..|:         .
  Rat   218 QPSLLGHPEPGLPTLAFQALQKIPTTLRTRLANTVVLAGGSTLFPGFVERMNLELQAQCRRHGYP 282

  Fly   320 ALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
            ||.|.     ::|.|.|..:||.|||::|||.:||:.|:::..|.|.||.:| |:.|
  Rat   283 ALQPC-----LVAHPGRGTAVWTGGSMMASLHSFQRRWMTRAMYQEYGPFLV-REVF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 109/315 (35%)
Actl10XP_003749645.1 NBD_sugar-kinase_HSP70_actin 25..329 CDD:302596 107/310 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.