DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6118 and ZBTB39

DIOPT Version :9

Sequence 1:NP_001097806.1 Gene:CG6118 / 41884 FlyBaseID:FBgn0038339 Length:967 Species:Drosophila melanogaster
Sequence 2:NP_055645.1 Gene:ZBTB39 / 9880 HGNCID:29014 Length:712 Species:Homo sapiens


Alignment Length:618 Identity:118/618 - (19%)
Similarity:186/618 - (30%) Gaps:239/618 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 LSWNNFHGNMCRGFHSLQKDEKMVDVTIAAGGKIFKAHKLVLSVCSPYFQQIFLENPSSHPILLM 459
            |...|...|:.:..:..:..|.|.||||..|.:.|.|||.||:..:.|||.:||..........:
Human     7 LQSTNHPNNLLKELNKCRLSETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFLNTGLDAARTYV 71

  Fly   460 AD-VEASHMAGLLDFMYSGQVNVKYEDLPVFLKVAEAMKIKGL-----HTEKNLDSD--ASDISS 516
            .| :..::...:|.|:|:.::.....::.|..:|||.:.::.|     .|..:|:|.  |..::|
Human    72 VDFITPANFEKVLSFVYTSELFTDLINVGVIYEVAERLGMEDLLQACHSTFPDLESTARAKPLTS 136

  Fly   517 PHESDGTECRYERGTHSVNITSGHAAGYGGAPSSQQSSPSPSLNGPNRCPTPLSSGGSGNPNYAG 581
            ..||           ||         |....||::.:.|...|.|          ||    :|.|
Human   137 TSES-----------HS---------GTLSCPSAEPAHPLGELRG----------GG----DYLG 167

  Fly   582 FREHIKSKATLAETFMKNLNRNNNNNNSSNNY---NHLGGSNGSLNLTEADSNSFAILQANSKKM 643
                                       :..||   :..|||                        
Human   168 ---------------------------ADRNYVLPSDAGGS------------------------ 181

  Fly   644 LDSARKQHKYLAKRKILMHYNTELGGEKRLKEMERDRYPSAEQHDDALNNNHS-HAQDNIMEPII 707
                                         .||         |:.:.|.:.||| |          
Human   182 -----------------------------YKE---------EEKNVASDANHSLH---------- 198

  Fly   708 TTIVPQTPPP----STHNNNFKIRLVESHHLTNNSNNNQNQSSNNNNSSSSPQSNDCNNDEEALN 768
               :||.|||    ..|:.......:.| .:|.......:.....:.||..|.....|.|     
Human   199 ---LPQPPPPPPKTEDHDTPAPFTSIPS-MMTQPLLGTVSTGIQTSTSSCQPYKVQSNGD----- 254

  Fly   769 LVQIPNANGSRNREATPTCATPTPDIQLIKREVKTELSPAEN--LSNNN-------GHDDEMAGA 824
                    .|:|...||..|              .:::...|  |||:.       |..||:...
Human   255 --------FSKNSFLTPDNA--------------VDITTGTNSCLSNSEHSKDPGFGQMDELQLE 297

  Fly   825 GF---DRKYDDNNNNSGLD---METDSNNNNSKPGGDNNNGLALALGKHKLLSAINRNIE----- 878
            ..   |.:::|...:.|..   :|...::.:....|:|:|....|:........:..||:     
Human   298 DLGDDDLQFEDPAEDIGTTEEVIELSDDSEDELAFGENDNRENKAMPCQVCKKVLEPNIQLIRQH 362

  Fly   879 -QDHPD---------HEH-QDQQDREA---DHGG------NNCNS-------------DDNNNNN 910
             :||.|         ..| ||:..|..   .|.|      :.|.:             |....||
Human   363 ARDHVDLLTGNCKVCETHFQDRNSRVTHVLSHIGIFLFSCDMCETKFFTQWQLTLHRRDGIFENN 427

  Fly   911 HSQHLD------LSTIKNIATAEILCGLKSKVL 937
            ...|.:      |......|:.|:.|....|||
Human   428 IIVHPNDPLPGKLGLFSGAASPELKCAACGKVL 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6118NP_001097806.1 Myb_DNA-bind_4 20..97 CDD:290549
BTB 408..508 CDD:279045 28/105 (27%)
BTB 419..510 CDD:197585 27/96 (28%)
ZBTB39NP_055645.1 BTB 20..119 CDD:306997 27/98 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..162 12/62 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..224 18/123 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..260 7/36 (19%)
C2H2 Zn finger 453..474 CDD:275368 4/8 (50%)
C2H2 Zn finger 482..502 CDD:275368
C2H2 Zn finger 510..530 CDD:275368
C2H2 Zn finger 540..560 CDD:275368
C2H2 Zn finger 607..627 CDD:275368
zf-H2C2_2 619..643 CDD:316026
C2H2 Zn finger 635..655 CDD:275368
C2H2 Zn finger 663..683 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7558
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.