DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6118 and CG15812

DIOPT Version :9

Sequence 1:NP_001097806.1 Gene:CG6118 / 41884 FlyBaseID:FBgn0038339 Length:967 Species:Drosophila melanogaster
Sequence 2:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster


Alignment Length:525 Identity:99/525 - (18%)
Similarity:190/525 - (36%) Gaps:137/525 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 LSWNNFHGNMCRGFHSLQKDEKMVDVTIAA-GGKIFKAHKLVLSVCSPYFQQIFLENP-SSHPIL 457
            |.|......:.....||:.|.:..:|.:|: .|...:||..|||.||...:.:.::.| .....:
  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68

  Fly   458 LMADVEASHMAGLLDFMYSGQVNVKYEDLPVFLKVAEAMKIKGLHTEKNLDSDASDISSPHESDG 522
            ::.|:....:..:|.|:|.|:.::....||.||   ||:.:.|:.:..:.:.:.|  :||...|.
  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFL---EAINLLGIKSAISFECNPS--ASPPSVDV 128

  Fly   523 TECRYERGTHSVNITSGHA-AGYGGAPS---SQQSSPSPSLNGPNRCPTPLSSGGSGNPNYAG-F 582
            .       .||:.:.|..: .|...|.:   ..:..|.|.::    .|....:|....|:::. .
  Fly   129 E-------NHSLAVESAKSITGLQIAEAELLDDEEEPHPMVS----VPATTLAGSQHQPSHSSRS 182

  Fly   583 REHI----KSKATLAETFMKNLNRNNNNNNSSNNYNHLGGSNGSLNLTEADSNSFAILQA----- 638
            .|:|    ..|.|.:...|        :.:||.|...|..:.|:..:|:: ::|.:.::|     
  Fly   183 LEYIDVYEPPKITYSIEHM--------DGSSSGNQFILTENTGTFTITQS-ASSLSKIEADETGT 238

  Fly   639 ----------------------NSKKMLDSARKQHKYLAKRKILMHYNTEL-------------- 667
                                  :..:|:|....|...|.:    :...||:              
  Fly   239 SGAEVDLGDDDVDADLAEDSEEHESQMIDEEFAQADPLME----LEAGTEMDDDDDVHDQLVDEE 299

  Fly   668 ---------GGEKRL------KEMER--DRYPSAEQH--------DDALNNNHSHAQDNIM---- 703
                     ||:.|:      |.::|  |..|:..|.        .|.:|:....|.|.::    
  Fly   300 IDDKPRKLGGGKTRIRRPISAKAVKRLSDCKPTRIQQFAALKREVKDDINDALDLAADAVIIEGL 364

  Fly   704 --------EPIITTIV---PQTPPPSTHNNNFKIRLVESHHLTNNSNNNQNQSSNNNNSSSSPQS 757
                    ..|..|::   .:|.|....||..:..|.|::....|.::.::.||......|:...
  Fly   365 SLQKAADRFDISKTVLWRRVRTNPAYMRNNRERPSLQEAYERLKNGHSLKSISSELQIPMSTLHR 429

  Fly   758 NDCNNDEEALNLVQIPNANGSRNREATPTCATPTPDIQLIKREVKTELSPAENLSNNNGHDDEMA 822
            :......:.    ::||....|.|:.||            |.|::.:|:.|.:...|.|.....|
  Fly   430 HKVRLSAQG----RLPNFVSCRKRDNTP------------KDELRDKLAKAVHACLNEGMSQNHA 478

  Fly   823 GAGFD 827
            ...|:
  Fly   479 ANLFE 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6118NP_001097806.1 Myb_DNA-bind_4 20..97 CDD:290549
BTB 408..508 CDD:279045 26/101 (26%)
BTB 419..510 CDD:197585 23/92 (25%)
CG15812NP_523897.2 BTB 20..113 CDD:279045 25/95 (26%)
BTB 35..118 CDD:197585 21/85 (25%)
HTH_psq 348..392 CDD:283007 7/43 (16%)
HTH_psq 458..501 CDD:283007 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.