DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6118 and CG8924

DIOPT Version :9

Sequence 1:NP_001097806.1 Gene:CG6118 / 41884 FlyBaseID:FBgn0038339 Length:967 Species:Drosophila melanogaster
Sequence 2:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster


Alignment Length:483 Identity:95/483 - (19%)
Similarity:179/483 - (37%) Gaps:157/483 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 QYLLSWNNFHGNMCRGFHSLQKDEKMVDVTIAAGGKIFKAHKLVLSVCSPYFQQIFLENPSSHPI 456
            ::.:.||:..|::...|..|...::.||||:|..|:....|:|||:.||.||:.|..|:|..||:
  Fly     7 EFCVRWNSHLGSIGAAFPQLLAGQRFVDVTLACEGQQVHCHRLVLAACSTYFEAILAEHPCKHPV 71

  Fly   457 LLM-ADVEASHMAGLLDFMYSGQVNVKYEDLPVFLKVAEAMKIKGLHTEKNLDSDASDISSPHES 520
            ::: .:::...:..|:||||.|:|||....|...|:.||.::|:||:                  
  Fly    72 IILPREIKLWEIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQIRGLY------------------ 118

  Fly   521 DGTECRYERGTHSVNITSGHAAGYGGAPSSQQSSPSPSLNGPNRCPTPLSSGGSGNPNYAGFREH 585
             |:|                      ||.:.:.....||.            .:.:|        
  Fly   119 -GSE----------------------APINYKKLQQASLE------------AAKDP-------- 140

  Fly   586 IKSKATLAETFMKNLNRNNNNNNSSNNYNHLGGSNGSLNLTEADSNSFAILQANSKKMLDSARKQ 650
               .||.|.:| |:::....::.::|       |..|..:|.:.:....:            ..|
  Fly   141 ---AATTARSF-KHVDSAETDDAATN-------STTSTTMTTSSAPPLPV------------NHQ 182

  Fly   651 HKYLAKRKILMHYNTELGGEKRLKEMERDRYPSAEQHDDALNNNHSHAQDNIME-PIITTIVPQT 714
            ...:.||                            |:.||........|..:.: |.|.....|.
  Fly   183 QPTVLKR----------------------------QNPDARQQQQQQQQQQVQQRPQINGSNAQQ 219

  Fly   715 PPPSTHNNNFKIRLVESHHLTNNSNNNQNQSSNNNNSSSSPQSNDCNNDEEAL-NLVQIPNANGS 778
            |..:|..|     ::.||......:::.::..||.|:... |.:|||...:|: |.:.:      
  Fly   220 PSKATSTN-----VLGSHSNAPTEDDSGDEVPNNWNAYGE-QFDDCNISAQAVDNKMNV------ 272

  Fly   779 RNREATPTCATPTPDIQLIKREVKTELSPAENLSNNNGHDDEMAGAGFDRKYDDNNNNS------ 837
                          .:.|.:..::.:|...:.|.:|...|.....|     :|:||::|      
  Fly   273 --------------HLSLQQARMQMQLQQQQYLDSNVEDDHNYVAA-----HDENNDSSFATGVP 318

  Fly   838 -----GLDMETDSNNNNSKPGGDNNNGL 860
                 .|.::||.:.:.:..||.:::.:
  Fly   319 CGSGLSLSLDTDLDTSANTSGGLSHSSI 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6118NP_001097806.1 Myb_DNA-bind_4 20..97 CDD:290549
BTB 408..508 CDD:279045 37/100 (37%)
BTB 419..510 CDD:197585 34/91 (37%)
CG8924NP_573091.1 BTB 25..117 CDD:279045 34/91 (37%)
BTB 34..117 CDD:197585 32/82 (39%)
MerR 378..407 CDD:278788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451910
Domainoid 1 1.000 68 1.000 Domainoid score I9675
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.