DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6118 and Zbtb37

DIOPT Version :10

Sequence 1:NP_001097806.1 Gene:CG6118 / 41884 FlyBaseID:FBgn0038339 Length:967 Species:Drosophila melanogaster
Sequence 2:NP_775600.1 Gene:Zbtb37 / 240869 MGIID:2444467 Length:504 Species:Mus musculus


Alignment Length:37 Identity:10/37 - (27%)
Similarity:19/37 - (51%) Gaps:1/37 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 QKAVLRHANLKLFVSHGG-MNSVLETMYYGVPMVIMP 399
            :|..|:..::.|.:|... :.||:..:.|.|.|.:.|
Mouse    92 KKPTLKTVSVCLAISGAAIVISVIALILYYVDMAVNP 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6118NP_001097806.1 Myb_DNA-bind_4 20..97 CDD:463994
BTB_POZ_BAB-like 418..500 CDD:349624
Zbtb37NP_775600.1 BTB_POZ_ZBTB37 9..131 CDD:349531 10/37 (27%)
C2H2 Zn finger 377..397 CDD:275368
zf-H2C2_2 389..414 CDD:463886
zf-C2H2 403..425 CDD:395048
C2H2 Zn finger 405..425 CDD:275368
zf-H2C2_2 418..440 CDD:463886
C2H2 Zn finger 433..451 CDD:275368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.