powered by:
Protein Alignment Atx2 and mfsd2a
DIOPT Version :9
Sequence 1: | NP_732033.1 |
Gene: | Atx2 / 41883 |
FlyBaseID: | FBgn0041188 |
Length: | 1084 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001072635.1 |
Gene: | mfsd2a / 780091 |
XenbaseID: | XB-GENE-951402 |
Length: | 525 |
Species: | Xenopus tropicalis |
Alignment Length: | 42 |
Identity: | 10/42 - (23%) |
Similarity: | 20/42 - (47%) |
Gaps: | 4/42 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 1045 LMCVHPQSL----LANHYFPPPTPQHPQQNQQQYQIVMQQHQ 1082
|:||.|..| |......|...:..:||::..|::.:.::
Frog 471 LICVAPVILILLGLLLFILYPINEEKRKQNKKALQLIRESNR 512
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5180 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.860 |
|
Return to query results.
Submit another query.