DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atx2 and mfsd2a

DIOPT Version :9

Sequence 1:NP_732033.1 Gene:Atx2 / 41883 FlyBaseID:FBgn0041188 Length:1084 Species:Drosophila melanogaster
Sequence 2:NP_001072635.1 Gene:mfsd2a / 780091 XenbaseID:XB-GENE-951402 Length:525 Species:Xenopus tropicalis


Alignment Length:42 Identity:10/42 - (23%)
Similarity:20/42 - (47%) Gaps:4/42 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1045 LMCVHPQSL----LANHYFPPPTPQHPQQNQQQYQIVMQQHQ 1082
            |:||.|..|    |......|...:..:||::..|::.:.::
 Frog   471 LICVAPVILILLGLLLFILYPINEEKRKQNKKALQLIRESNR 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atx2NP_732033.1 SM-ATX 61..128 CDD:291131
mfsd2aNP_001072635.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
MFS_NLS1_MFSD2A 38..494 CDD:341009 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5180
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.