DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6125 and Slc26a8

DIOPT Version :9

Sequence 1:NP_732032.1 Gene:CG6125 / 41882 FlyBaseID:FBgn0038337 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_011244686.1 Gene:Slc26a8 / 224661 MGIID:2385046 Length:1027 Species:Mus musculus


Alignment Length:495 Identity:116/495 - (23%)
Similarity:229/495 - (46%) Gaps:76/495 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 FLSWITSYD-REQAFADLIAGITLGLTIIPQSIAYAALAG--LSSEYGLYSAFIGSIIYVFFGTI 147
            ||.||..|. ::....||:||:::||..:||.:..:.|..  :......|:||..|:|||.||:.
Mouse   105 FLEWICLYRFKDWLLGDLLAGLSVGLVQVPQGLILSLLTRQLIPPLNVTYAAFCSSVIYVIFGSC 169

  Fly   148 PQVSIGPTSLMAILTLQFCADKP----------------------------VQVVIVLAFLAGLV 184
            .|:||||..|::.|.:....|:|                            :.:|....||.|::
Mouse   170 HQMSIGPFFLVSALMINVLKDRPFNNGHLILGTFVKDDFSVPTFYLSYNRSLSMVASTTFLTGII 234

  Fly   185 ELAMGVFQLGFIVSFIPAPVTKAFTSGTALIVVFAQIKNLLGVRIKGFPSIGDFFTNIRPTDAAM 249
            :|:||:..:||:.:::|...|.|:.:..||.::.||:..:||:.:........|..||       
Mouse   235 QLSMGMLGMGFMATYLPEAATSAYLAAVALHIILAQMTCILGIMVSFHAGPISFIYNI------- 292

  Fly   250 GISCMVVLLSLRLLSQVNFKQDTPVTRRLKKILWYISISRNALVVFFTGLLVFIWVKKSSIEAVP 314
             |:..:.|......|.:.|.... |..|:.|.   |.|:.|...:.|...|:.|         :.
Mouse   293 -INYCIALPKANSTSILLFITSV-VALRINKC---IRITFNRYPIEFPMELLLI---------LG 343

  Fly   315 FA-LSSKVSSAMPTIK----LPPFAFEY-QNRTYVFTDILHELGSGIVVVPIVAVLANVAIAKAF 373
            |: |:||::.|....|    :.|::|.: :|..:   .||..:....:.:..|:....:::.|..
Mouse   344 FSLLTSKITMATENSKMLMNMIPYSFVFPENPEF---GILSRVVLQALSLSFVSSFLLISLGKKI 405

  Fly   374 VKDGN--LDASQEMLTLGLCNIAGSFFSAMPTCGAFTRSAVSQASGVRTPMAGIYTGLIVLSALS 436
            ....|  .:::|:::.:||||:..|||......|:.:|:.:...||.|...|.:....::|..:.
Mouse   406 ANFHNYRTNSNQDLIAIGLCNLLSSFFKCCVFTGSLSRTTIQDKSGGRQQFASLVGAGVMLLLMV 470

  Fly   437 ILTPYFQYIPKASLSAVLIAAVI-FMIDLAPVKELWQTNKKDFFSWVGSFIICLVAGVELGLLFG 500
            .:..:|..:|.|.|:.::::.|: ::..:..:..||:.::.:...|:.:|...::.|:::|||  
Mouse   471 KMESFFHNLPNAVLAGIILSNVVPYLEAIYNLPSLWRQDQYECIIWMVTFSSAILLGLDVGLL-- 533

  Fly   501 IVLSMVFILLRLGNPKFEVTLKQHESTYYV-HIVPQSDVY 539
              :|:.|..       |.:|::.|.:...| ..:|.:::|
Mouse   534 --ISLAFTF-------FVITIRSHRTKILVLGQIPNTNIY 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6125NP_732032.1 sulP 87..620 CDD:273284 115/494 (23%)
HCO3_cotransp 108..462 CDD:304903 91/392 (23%)
STAS 530..608 CDD:294402 3/11 (27%)
Slc26a8XP_011244686.1 sulP 104..610 CDD:273284 116/495 (23%)
STAS_SulP_like_sulfate_transporter <747..806 CDD:132913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289441at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X49
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.