DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp and RUD3

DIOPT Version :9

Sequence 1:NP_001189227.1 Gene:Rbp / 41880 FlyBaseID:FBgn0262483 Length:1844 Species:Drosophila melanogaster
Sequence 2:NP_014859.3 Gene:RUD3 / 854391 SGDID:S000005742 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:29/145 - (20%)
Similarity:60/145 - (41%) Gaps:28/145 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QKHKQQKSRPRGSHSMPYESMHHHQSAAAAVAAGTTPNGMLDALSLQLRDAEMRRTEIERAHQET 93
            :.:||..|..|.......:::..|:...|.:      ...|:.|.|::.:.:.:|.|..|...:.
Yeast   265 ENNKQDISDLRTERDELRQALESHEKEKAVL------KNSLNDLELKIEEVDNKREEEARERDQE 323

  Fly    94 LAQIRNLSGSA----RPDAEAVENLQSRARELEKKVALENVRCEE-----LQI------------ 137
            :..:|:...:.    ..|.||:|:::.:...:::..:::....||     |||            
Yeast   324 VKSLRSQLDTEIETHNNDTEALESMKKQLEAMKEDASMKEKYEEESKQHILQIGKLRHEAIILNE 388

  Fly   138 ELTSAL-KAKQASRS 151
            .||.|| ..|::|.|
Yeast   389 HLTKALAMLKKSSDS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RbpNP_001189227.1 SH3 609..677 CDD:302595
FN3 748..822 CDD:238020
FN3 844..907 CDD:238020
SH3_RIM-BP_2 1319..1380 CDD:212945
SH3_RIM-BP_3 1446..1507 CDD:212946
RUD3NP_014859.3 SMC_prok_A 88..>382 CDD:274009 22/122 (18%)
GRAB 401..449 CDD:402134 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5407
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.