DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rbp and lamb4

DIOPT Version :9

Sequence 1:	NP_001189227.1	Gene:	Rbp / 41880	FlyBaseID:	FBgn0262483	Length:	1844	Species:	Drosophila melanogaster
Sequence 2:	NP_775383.1	Gene:	lamb4 / 286831	ZFINID:	ZDB-GENE-021226-2	Length:	1827	Species:	Danio rerio

Alignment Length:	136	Identity:	31/136 - (22%)
Similarity:	60/136 - (44%)	Gaps:	10/136 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 NVEEE-NRRPEKAAAAASKKQKHKQQKSRPRGSHSMPYESMHHHQSAAAAVAAGTTPNGMLDALS 73
            |:|:. |....|......:..|:|.:.:|.:|..:        ..:|.||:.:.......|:.|.
Zfish  1680 NIEDHLNLTRAKTLLDEIEALKNKTEMNRAQGKEA--------KDTADAALNSANDTGKDLEELK 1736

  Fly    74 LQLRDAEMRRTEIERAHQETLAQIRNLSGSARPDAEAVENLQSRARELEKKVALENVRCEELQIE 138
            .|....::..|. :....|...:::|::..|...|:.||:......:||:|:.|.|.|.:|::.|
Zfish  1737 EQFEKLKLNSTN-QNVSSEANERLKNITMEAENLAKHVEDKMKEIEDLEEKILLSNERKDEMRKE 1800

  Fly   139 LTSALK 144
            |.:..|
Zfish  1801 LEALQK 1806

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rbp	NP_001189227.1	SH3	609..677	CDD:302595
		FN3	748..822	CDD:238020
		FN3	844..907	CDD:238020
		SH3_RIM-BP_2	1319..1380	CDD:212945
		SH3_RIM-BP_3	1446..1507	CDD:212946
lamb4	NP_775383.1	Laminin_N	43..265	CDD:278484
		EGF_Lam	266..324	CDD:238012
		Laminin_EGF	397..446	CDD:278482
		EGF_Lam	449..498	CDD:238012
		EGF_Lam	500..>539	CDD:238012
		EGF_Lam	853..898	CDD:214543
		EGF_Lam	900..943	CDD:238012
		EGF_Lam	946..993	CDD:238012
		EGF_Lam	994..1049	CDD:238012
		Laminin_EGF	1054..1098	CDD:278482
		EGF_Lam	1106..1160	CDD:214543
		EGF_Lam	1162..1205	CDD:238012
		EGF_Lam	1211..1259	CDD:238012
		Domain II	1258..1449
		Domain alpha	1450..1476
		Domain I	1477..1827		31/136 (23%)
		COG1340	1525..1813	CDD:224259	31/136 (23%)
		SPEC	1567..1782	CDD:238103	21/110 (19%)
		TMF_DNA_bd	1773..>1813	CDD:289127	12/34 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R5407
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.030