DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h-cup and SIKE1

DIOPT Version :9

Sequence 1:NP_650462.1 Gene:h-cup / 41879 FlyBaseID:FBgn0038334 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001095866.1 Gene:SIKE1 / 80143 HGNCID:26119 Length:211 Species:Homo sapiens


Alignment Length:224 Identity:56/224 - (25%)
Similarity:88/224 - (39%) Gaps:74/224 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DELLIDAK---------------MVDQELANCHK----FRE------DQLLKHLTEKNDDDEQM- 70
            :::|.|||               :|||..| .|:    .||      ||:.:...|...|.:.| 
Human     6 EKILTDAKTLLERLREHDAAAESLVDQSAA-LHRRVAAMREAGTALPDQVRQRYQEDASDMKDMS 69

  Fly    71 ----------------QLLRENIELKATGVEFQHGIELIMEKYREHS----------EGDMLIDT 109
                            .|.:||.||..:..|.|..:||||.|||:..          :.:.::..
Human    70 KYKPHILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKAVDAEPVLKA 134

  Fly   110 YQLREHYLAGLSKVVEEQDARIERMVDVMKLTVDFEDRSSAENQQIICQLTDENEQLRRQLQIST 174
            :|  .|     |..:|.|..||..|.:||:..|..:|....:.|:.:.||..||::||..|.||:
Human   135 HQ--SH-----SAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISS 192

  Fly   175 TDELFRQGALSSSESSTQIGPNDSLDSSA 203
                          .|.|....:|:|:::
Human   193 --------------ESLQARKENSMDTAS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
h-cupNP_650462.1 DUF837 12..173 CDD:283437 50/192 (26%)
SIKE1NP_001095866.1 DUF837 2..191 CDD:310401 50/192 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003688
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12186
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.