Sequence 1: | NP_650462.1 | Gene: | h-cup / 41879 | FlyBaseID: | FBgn0038334 | Length: | 256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080494.1 | Gene: | Fgfr1op2 / 67529 | MGIID: | 1914779 | Length: | 253 | Species: | Mus musculus |
Alignment Length: | 236 | Identity: | 57/236 - (24%) |
---|---|---|---|
Similarity: | 97/236 - (41%) | Gaps: | 57/236 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 AESGLIKEYKDFAKCLDELEFKTDELLIDAKMVDQELANCHKFR-EDQLLKHLTEKNDDDEQMQL 72
Fly 73 LRENIELKATGVEFQHGIELIMEKYRE-----------------------HSEGDML-------- 106
Fly 107 -IDT---------YQLREHYLAGLSKVVEEQDARIERMVDVMKLTVDFEDRSSAENQQIICQLTD 161
Fly 162 ENEQLRRQLQISTTDELF---RQGALSSSESSTQIGPNDSL 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
h-cup | NP_650462.1 | DUF837 | 12..173 | CDD:283437 | 46/202 (23%) |
Fgfr1op2 | NP_080494.1 | SIKE | 2..221 | CDD:399056 | 48/207 (23%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 231..253 | 5/18 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0003688 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12186 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
3 | 3.060 |