DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h-cup and Fgfr1op2

DIOPT Version :9

Sequence 1:NP_650462.1 Gene:h-cup / 41879 FlyBaseID:FBgn0038334 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_080494.1 Gene:Fgfr1op2 / 67529 MGIID:1914779 Length:253 Species:Mus musculus


Alignment Length:236 Identity:57/236 - (24%)
Similarity:97/236 - (41%) Gaps:57/236 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AESGLIKEYKDFAKCLDELEFKTDELLIDAKMVDQELANCHKFR-EDQLLKHLTEKNDDDEQMQL 72
            |...||::....:|.::.::...:|:        |||....:.| ...|:..:.::|....::| 
Mouse    25 AAESLIEQTTALSKRVEAMKQYQEEI--------QELNEVARHRPRSTLVMGIQQENRQIRELQ- 80

  Fly    73 LRENIELKATGVEFQHGIELIMEKYRE-----------------------HSEGDML-------- 106
             :||.||:.:..|.|..:||||.||||                       ||:.||:        
Mouse    81 -QENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQHSKIDMVHRNSCEGF 144

  Fly   107 -IDT---------YQLREHYLAGLSKVVEEQDARIERMVDVMKLTVDFEDRSSAENQQIICQLTD 161
             :|.         :.|...:|......::....:|..|..||:..::.:::...:.|:.|.||..
Mouse   145 FLDASRHILEAPQHGLERRHLEANQNELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQ 209

  Fly   162 ENEQLRRQLQISTTDELF---RQGALSSSESSTQIGPNDSL 199
            ||:.||..|||  |.|.|   |:...|.|.|.:.:..|..|
Mouse   210 ENKGLREILQI--TRESFLNLRKDDASESTSLSALVTNSDL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
h-cupNP_650462.1 DUF837 12..173 CDD:283437 46/202 (23%)
Fgfr1op2NP_080494.1 SIKE 2..221 CDD:399056 48/207 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..253 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003688
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12186
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.060

Return to query results.
Submit another query.