DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h-cup and Sike1

DIOPT Version :9

Sequence 1:NP_650462.1 Gene:h-cup / 41879 FlyBaseID:FBgn0038334 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_079955.1 Gene:Sike1 / 66641 MGIID:1913891 Length:207 Species:Mus musculus


Alignment Length:216 Identity:52/216 - (24%)
Similarity:84/216 - (38%) Gaps:70/216 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DELLIDAK---------------MVDQELANCHK---------------FRED--------QLLK 58
            :::|.|||               :|||..| .|:               ::||        :...
Mouse     6 EKILTDAKTLLERLREHDAAAESLVDQSAA-LHRRVAAMREAGAVLPEQYQEDASDVKDMSKYKP 69

  Fly    59 HLTEKNDDDEQMQLLRENIELKATGVEFQHGIELIMEKYREHS----------EGDMLIDTYQLR 113
            |:....::.:...|.:||.||..:..|.|..:||||.|||:..          :.:.::..:|  
Mouse    70 HILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKYRKQMLQLMVAKKAVDAEPVLKAHQ-- 132

  Fly   114 EHYLAGLSKVVEEQDARIERMVDVMKLTVDFEDRSSAENQQIICQLTDENEQLRRQLQISTTDEL 178
            .|     |..:|.|..||..|..||:..|..:|....:.|:.:.||..||::||..|.||:    
Mouse   133 SH-----SAEIESQIDRICEMGAVMRRAVQVDDNQFCKVQERLAQLELENKELRELLSISS---- 188

  Fly   179 FRQGALSSSESSTQIGPNDSL 199
                      .|.|:|...|:
Mouse   189 ----------ESLQVGKESSV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
h-cupNP_650462.1 DUF837 12..173 CDD:283437 46/188 (24%)
Sike1NP_079955.1 DUF837 2..187 CDD:283437 46/188 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003688
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12186
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.060

Return to query results.
Submit another query.