DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h-cup and sike1

DIOPT Version :9

Sequence 1:NP_650462.1 Gene:h-cup / 41879 FlyBaseID:FBgn0038334 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_012816903.1 Gene:sike1 / 496965 XenbaseID:XB-GENE-1003385 Length:260 Species:Xenopus tropicalis


Alignment Length:209 Identity:49/209 - (23%)
Similarity:89/209 - (42%) Gaps:63/209 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DELLIDAK---------------MVDQELANCH---------------KFRED--------QLLK 58
            |::|.|||               ::||..| .|               |::|:        :|..
 Frog    59 DKILQDAKTLLERLKDHDNAAESLIDQSSA-LHKRVEAMKEVGTAMPEKYQEELADIKDASKLKP 122

  Fly    59 HLTEKNDDDEQMQLLRENIELKATGVEFQHGIELIMEKYREH----------SEGDMLIDTYQLR 113
            |:....::.:...|.:||.||..:..|.|:.:||||.|||:.          :..:.:::.::. 
 Frog   123 HVLLCQENTQIRDLQQENKELWVSLEEHQYALELIMSKYRKQMLQLVANKKPAPTEPVLEAHKT- 186

  Fly   114 EHYLAGLSKVVEEQDARIERMVDVMKLTVDFEDRSSAENQQIICQLTDENEQLRRQLQISTTDEL 178
                  .|..:|.|..||..|.|:|:..:..::..:...|:.:.||..||::||..|  ||:.| 
 Frog   187 ------FSSDLECQIDRICVMGDIMRDAIQLDEDKAYNIQEKLAQLELENKELREIL--STSKE- 242

  Fly   179 FRQGALSSSESSTQ 192
                :|.||:..::
 Frog   243 ----SLHSSKRESE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
h-cupNP_650462.1 DUF837 12..173 CDD:283437 43/188 (23%)
sike1XP_012816903.1 DUF837 55..240 CDD:283437 44/190 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003688
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12186
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.