DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h-cup and sike1

DIOPT Version :9

Sequence 1:NP_650462.1 Gene:h-cup / 41879 FlyBaseID:FBgn0038334 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_009295355.1 Gene:sike1 / 449731 ZFINID:ZDB-GENE-090312-146 Length:211 Species:Danio rerio


Alignment Length:181 Identity:49/181 - (27%)
Similarity:89/181 - (49%) Gaps:25/181 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IKEYKDFAKCLDELEFKTDELLIDAKMVDQELANCHKFRED-----QLLKH-----LTEKNDDDE 68
            :||:...|:.|.|......:.:...|.|...|.:  |:.|:     :|.::     |:::|...:
Zfish    19 LKEHDTAAESLIEQSSVLGQKIHSMKEVGNTLPD--KYMEENTEYQELSRYKPHVLLSQENTQIK 81

  Fly    69 QMQLLRENIELKATGVEFQHGIELIMEKYREHSEGDML----IDT---YQLREHYLAGLSKVVEE 126
            ::|  :||.||..:..|.|:.:||||.:||:.....|:    :||   ..|.:::    :|.|:.
Zfish    82 ELQ--QENRELWLSLEEHQYALELIMGRYRKQMLQMMMEKKELDTKPVLSLHQNH----AKEVQS 140

  Fly   127 QDARIERMVDVMKLTVDFEDRSSAENQQIICQLTDENEQLRRQLQISTTDE 177
            |..||..|..||:..|..:|:.....::.:.||..||::||..|.||:..:
Zfish   141 QLGRICEMGQVMRQAVQMDDQHYCSVKERLAQLEIENKELRGLLSISSVKQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
h-cupNP_650462.1 DUF837 12..173 CDD:283437 47/175 (27%)
sike1XP_009295355.1 DUF837 2..187 CDD:283437 47/175 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003688
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12186
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.