DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h-cup and fgfr1op2

DIOPT Version :9

Sequence 1:NP_650462.1 Gene:h-cup / 41879 FlyBaseID:FBgn0038334 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001006846.1 Gene:fgfr1op2 / 448596 XenbaseID:XB-GENE-975391 Length:216 Species:Xenopus tropicalis


Alignment Length:202 Identity:56/202 - (27%)
Similarity:93/202 - (46%) Gaps:24/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GAESGLIKEYKDFAKCLDELEFKTDELLIDAKMVDQELANCHKFR-EDQLLKHLTEKNDDDEQMQ 71
            ||...||::.....|.::.::...:|:        |||....:.| ...|:..:.::|....|:|
 Frog    24 GAAEVLIEQTTTLNKRVEAMKQYQEEV--------QELNEIARHRPRSTLVLGIQQENRQIRQLQ 80

  Fly    72 LLRENIELKATGVEFQHGIELIMEKYREH-------SEGDMLIDTYQLREHYLAGLSKVVEEQDA 129
              :||.||:.:..|.|..:||||.||||.       |:.|......:|:|.:    ||.::....
 Frog    81 --QENKELRTSLKEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQH----SKELQAHIE 139

  Fly   130 RIERMVDVMKLTVDFEDRSSAENQQIICQLTDENEQLRRQLQISTTD--ELFRQGALSSSESSTQ 192
            :|..|..|||..::.:::...:....|.:|..||:.||:.|||:...  .|.::.|..||..|..
 Frog   140 KITEMTAVMKRAIEIDEQQGNQEHDRIVKLEQENKWLRKTLQITRASFLNLHKEDAAESSSHSAS 204

  Fly   193 IGPNDSL 199
            ..||..|
 Frog   205 SVPNTDL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
h-cupNP_650462.1 DUF837 12..173 CDD:283437 45/168 (27%)
fgfr1op2NP_001006846.1 SIKE 2..183 CDD:368605 47/172 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..216 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003688
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12186
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.