DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h-cup and Fgop2

DIOPT Version :9

Sequence 1:NP_650462.1 Gene:h-cup / 41879 FlyBaseID:FBgn0038334 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001260171.1 Gene:Fgop2 / 33971 FlyBaseID:FBgn0031871 Length:315 Species:Drosophila melanogaster


Alignment Length:250 Identity:60/250 - (24%)
Similarity:115/250 - (46%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIKEYKDFAKCLDELEFKTDELLIDAKMVDQELANCHKFRED--------------QLLKHLTEK 63
            :|.:.:..|..:.:|:.....||.:|:..::.:.:..::::|              .::..:.::
  Fly     9 IIMDAQRMASRVKDLDALGTALLEEAENNNRLVESLRQYQDDIESLNRISNNKTNADMVNRIQQQ 73

  Fly    64 NDDDEQMQLLRENIELKATGVEFQHGIELIMEKYREHSEGDMLIDTYQLREHYLAGLSKVVEEQD 128
            |.:..  ::|:||.|||....:::..:||:|:|||||:...:|...:..:|.|...:.:|:.||.
  Fly    74 NINSS--EILKENRELKIFIEDYERAMELMMQKYREHTVSKVLDSKFSFKELYNERMWQVIREQR 136

  Fly   129 ARIERMVDVMKLTVDFEDRSSAENQQIICQLTDENEQLRRQLQIS-----------TTDELFRQG 182
            .:|..|..||:|....:|.......|.|.||..|||.||..||||           .:|.|..:.
  Fly   137 EKINEMAAVMQLAASVDDGVVQRELQTISQLRLENETLRELLQISKQYGSSQRPIRESDHLLEEK 201

  Fly   183 ALSSSESSTQIGPNDSLDSSATRENSIYSIDSFLSCLSPSSVEDDSECSSNNSLL 237
            |:.:..::     :||.|..:               :|.:|||:    .:|||::
  Fly   202 AVQTDSTA-----DDSADDLS---------------ISGASVEN----MNNNSVI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
h-cupNP_650462.1 DUF837 12..173 CDD:283437 45/173 (26%)
Fgop2NP_001260171.1 DUF837 3..181 CDD:283437 45/173 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003688
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12186
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.