DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h-cup and fgfr1op2

DIOPT Version :9

Sequence 1:NP_650462.1 Gene:h-cup / 41879 FlyBaseID:FBgn0038334 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_956249.1 Gene:fgfr1op2 / 335511 ZFINID:ZDB-GENE-030131-7451 Length:215 Species:Danio rerio


Alignment Length:208 Identity:51/208 - (24%)
Similarity:92/208 - (44%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIKEYKDFAKCLDELEFKTDELLIDAKMVDQELANCHKFRED-----QLLKH---------LTEK 63
            ::.:.|...:.|.:.:...:.|:....::::.:....:::|:     |:.:|         :.::
Zfish     8 VLADAKSLVERLRDHDSAAEILIEQTTLLNKRVEAMKQYQEEIEVLNQVARHRPRSTLVMGIQQE 72

  Fly    64 NDDDEQMQLLRENIELKATGVEFQHGIELIMEKYREH--------SEGDMLIDTYQLREHYLAGL 120
            |....::|  :||.||..:..|.|..:||||.||||.        .:.|..|.| ||||.:    
Zfish    73 NRQIRELQ--QENKELHTSLEEHQSALELIMSKYREQVFRLLMASKKEDPTIVT-QLREQH---- 130

  Fly   121 SKVVEEQDARIER---MVDVMKLTVDFEDRSSAENQQIICQLTDENEQLRRQLQISTTDELFRQG 182
               ..|..|.||:   |..||:..::.::....|:::.|.:|..||..||..|.||.  |.|...
Zfish   131 ---TNEMQAHIEKINEMATVMRKAIEVDEGRLCEDEERIKRLELENSGLRELLGISR--EAFLLL 190

  Fly   183 ALSSSESSTQIGP 195
            ....:..||.:.|
Zfish   191 KRDDTSDSTSLSP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
h-cupNP_650462.1 DUF837 12..173 CDD:283437 44/184 (24%)
fgfr1op2NP_956249.1 DUF837 2..183 CDD:283437 44/184 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003688
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12186
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.