DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h-cup and FGFR1OP2

DIOPT Version :9

Sequence 1:NP_650462.1 Gene:h-cup / 41879 FlyBaseID:FBgn0038334 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_056448.1 Gene:FGFR1OP2 / 26127 HGNCID:23098 Length:253 Species:Homo sapiens


Alignment Length:234 Identity:54/234 - (23%)
Similarity:97/234 - (41%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IKEYKDFAKCLDELEFKTDELLIDAKMVDQELANCHKFREDQ----LLKHLTEKNDDDEQMQLLR 74
            ::::.|.|:.|.|.....::.:...|...:|:...::....:    |:..:.::|....::|  :
Human    19 LRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHRPRSTLVMGIQQENRQIRELQ--Q 81

  Fly    75 ENIELKATGVEFQHGIELIMEKYRE-----------------------HSEGDML---------I 107
            ||.||:.:..|.|..:||||.||||                       ||:.||:         :
Human    82 ENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQHSKIDMVHRNKSEGFFL 146

  Fly   108 DT---------YQLREHYLAGLSKVVEEQDARIERMVDVMKLTVDFEDRSSAENQQIICQLTDEN 163
            |.         :.|...:|......::....:|..|..||:..::.:::...:.|:.|.||..||
Human   147 DASRHILEAPQHGLERRHLEANQNELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQEN 211

  Fly   164 EQLRRQLQISTTDELF---RQGALSSSESSTQIGPNDSL 199
            :.||..|||  |.|.|   |:...|.|.|.:.:..|..|
Human   212 KGLREILQI--TRESFLNLRKDDASESTSLSALVTNSDL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
h-cupNP_650462.1 DUF837 12..173 CDD:283437 44/203 (22%)
FGFR1OP2NP_056448.1 SIKE 2..221 CDD:399056 45/205 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..253 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003688
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12186
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.