DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h-cup and C14B1.8

DIOPT Version :9

Sequence 1:NP_650462.1 Gene:h-cup / 41879 FlyBaseID:FBgn0038334 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_497753.1 Gene:C14B1.8 / 182593 WormBaseID:WBGene00007579 Length:231 Species:Caenorhabditis elegans


Alignment Length:272 Identity:54/272 - (19%)
Similarity:107/272 - (39%) Gaps:86/272 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSSVPSGAESGLIKEYKDFAKCLDELEFKTDELLIDAKMVDQELANCHKFREDQLLKHLTEKND 65
            ||:  ||.....|::...|......:.|:..|.:|..|..|...:::.:|:  ::||:.:.:...
 Worm     1 MDN--PSKEIDLLLQSSYDMTILTKQGEYNVDSMLSRAHHVASRISSMYKY--EKLLQDMQDLTV 61

  Fly    66 DDEQMQLL-----RENIELKATGVEFQHGIELIMEKYREHSEGDMLIDTYQLRE---HYLAGLSK 122
            :..:.:|:     |||.::.|           :.::.|            ||||   .|||.:..
 Worm    62 NGNRRKLILNDLQRENKQIMA-----------LQDENR------------QLRETTQEYLATMRN 103

  Fly   123 VVEEQDARIERMVDVMKLTVDFEDRSSAENQQIICQL--TDENEQLRR----------------- 168
            :::.. |.||..:::.::..|.:|   |:..:||.::  ||:..:|::                 
 Worm   104 ILDSH-AEIEGSIEMGQMNSDIDD---ADIDRIIFEMANTDQEARLKKKALEMELMMDDLEKMRK 164

  Fly   169 ----QLQISTT-----DELFRQGALSSSESSTQIGPNDSLDSSATRENSIYSIDSFLSCLSPSSV 224
                :||::..     .|||:....|:..:                 |||  ::|.:..:|....
 Worm   165 EEYQELQLAVQRNKNYKELFKLACFSNQSA-----------------NSI--LNSAMKIISEGDG 210

  Fly   225 EDDSECSSNNSL 236
            .||.|...|..|
 Worm   211 FDDDEAQENEDL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
h-cupNP_650462.1 DUF837 12..173 CDD:283437 36/191 (19%)
C14B1.8NP_497753.1 DUF3585 30..>110 CDD:304905 20/105 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12186
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.