DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6136 and cutc

DIOPT Version :9

Sequence 1:NP_001189224.1 Gene:CG6136 / 41877 FlyBaseID:FBgn0038332 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_031760893.1 Gene:cutc / 496655 XenbaseID:XB-GENE-1005045 Length:279 Species:Xenopus tropicalis


Alignment Length:253 Identity:106/253 - (41%)
Similarity:148/253 - (58%) Gaps:8/253 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EMSNHDIKLEVCVDSIRSAFAAEEGGASRIELCSALGEGGLTPSIGTLKTIKETLTMPIYCMLRP 68
            ||::....:||||||:.||..||.|||.|||||::|.|||:|||:|.|:.:|:.|.:||:.|:||
 Frog    27 EMADQGYIMEVCVDSVESAINAERGGAGRIELCASLLEGGITPSVGLLQVVKQYLQIPIFVMIRP 91

  Fly    69 RRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLLASGGLPVTFHRAF 133
             ||.||:|||.|:..:..|:.|.:.:||||.|||:|..|..|:.:.|..:|..|..|||||||||
 Frog    92 -RGGDFLYSDREVEVMKADIRLAKIHGADGLVFGALTEDGRIDAELCMELLAVSRPLPVTFHRAF 155

  Fly   134 DLTDQKSMDENVDMLRELGFRRLLSSGFRPTAADGVDCLAQLIAKHQRDFIVMPGAGIKVSNLEE 198
            |:.....:  .::.|..|||.|:|:||...:|.:|:..:.:|:.:.:...|||||.||...||:.
 Frog   156 DMVYDPLL--AMETLISLGFERVLTSGCDTSALEGLPLIKRLVEQAKGRIIVMPGGGITERNLQR 218

  Fly   199 ILTVSRCLEFHASALDTAGEDYVAPTTTRMECDVTMGKQDVDPYYGTNSIVVRKMVTI 256
            ||..:...|||.||..|...     |.......|.||.......|.|....|.|:.|:
 Frog   219 ILEGAAVQEFHCSARSTKDS-----TMKYRNNSVCMGATLSTSEYSTKVTDVAKVRTL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6136NP_001189224.1 CutC 10..259 CDD:225684 104/247 (42%)
cutcXP_031760893.1 CutC 33..276 CDD:225684 104/247 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3543
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9318
Inparanoid 1 1.050 181 1.000 Inparanoid score I3876
OMA 1 1.010 - - QHG62661
OrthoDB 1 1.010 - - D1619869at2759
OrthoFinder 1 1.000 - - FOG0006124
OrthoInspector 1 1.000 - - oto103786
Panther 1 1.100 - - LDO PTHR12598
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4415
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.080

Return to query results.
Submit another query.