DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6171 and Aplf

DIOPT Version :9

Sequence 1:NP_001097801.1 Gene:CG6171 / 41872 FlyBaseID:FBgn0026737 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_008761298.1 Gene:Aplf / 500247 RGDID:1565557 Length:510 Species:Rattus norvegicus


Alignment Length:225 Identity:72/225 - (32%)
Similarity:103/225 - (45%) Gaps:39/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VKSEEPVASIKDETNPEVPM-KIKAEPVENADEPTSTTPAIKIKAE-----PADNGNSPAAAMVK 97
            ||:.:...:|..|...|.|. |...:|..|..:.|.:.|..:...:     ....|..|.::...
  Rat   292 VKANKLSDTISAEELGEAPKHKAVTKPTTNDKDKTMSHPKCRAGVQSKTFLEKSQGCHPESSSAP 356

  Fly    98 TEPTNSNAQDA------ADESTVSSSSIRTSCRFGIRCYRRNPAHRSAEAHPGDQDYRRPNFPAP 156
            :.|..|:...|      ::||.|.    ||||.:|..|||:||.|....:||||.||..  .|..
  Rat   357 SSPGASHTDTADSVLGCSEESKVR----RTSCMYGANCYRKNPLHFQHFSHPGDSDYGA--VPVT 415

  Fly   157 PLGT----PACPFGNACYRRNPVHFQDYSHPADFNSAQNIRNRLRQRRAQRQNDDDSG----TDE 213
            ..|.    |.||:|.:|||:||.|..:|.|.|           |..|.|..::|||.|    :|:
  Rat   416 DEGVTGDRPECPYGASCYRKNPQHRMEYRHSA-----------LPARVAVDEDDDDVGQPSDSDK 469

  Fly   214 EDEPFGGDNDRDADYRPGADINEDED-DEL 242
            ::|.: ...|.|:|::||.|..|.|| |||
  Rat   470 DEEDY-APTDEDSDWQPGKDDEEKEDVDEL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6171NP_001097801.1 zf-CCHH 122..142 CDD:287283 9/19 (47%)
zf-CCHH 161..182 CDD:287283 11/20 (55%)
AplfXP_008761298.1 FHA 4..102 CDD:238017
zf-CCHH 383..403 CDD:287283 9/19 (47%)
zf-CCHH 424..445 CDD:287283 11/20 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334339
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_290VG
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008022
OrthoInspector 1 1.000 - - oto98681
orthoMCL 1 0.900 - - OOG6_108760
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.640

Return to query results.
Submit another query.