DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6171 and aplf

DIOPT Version :9

Sequence 1:NP_001097801.1 Gene:CG6171 / 41872 FlyBaseID:FBgn0026737 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001353181.1 Gene:aplf / 101884102 ZFINID:ZDB-GENE-111123-1 Length:475 Species:Danio rerio


Alignment Length:262 Identity:67/262 - (25%)
Similarity:103/262 - (39%) Gaps:50/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSATDASTADSGAKRKSSEDITHNCNANFGAENGLRKRVKS---EEPVASIKDETNP----EVPM 58
            ||:.:....|...|||:                   ||:||   ||.:..:.|.|.|    .||.
Zfish   225 MSSEEEELEDKTPKRKT-------------------KRLKSDSEEESLPPLDDATAPSGESSVPD 270

  Fly    59 KIKAEPVENADEPTSTTPAIKIKAEPADNGNSPAAAMVKTEPTNSN--AQDAADESTVSSSSI-- 119
            .:....|...::........:.:..|.|...:   :..:||..:.:  ::..:..|.|:.|.|  
Zfish   271 GVNGTGVMERNDEERKGGGRRAQVRPGDQAQN---SKTQTEDRSDSQVSRGLSQRSDVTESEIKT 332

  Fly   120 ---------RTSCRFGIRCYRRNPAHRSAEAHPGDQDYRRPNFPAPPL---GTPACPFGNACYRR 172
                     ||:|.:|..|||:||.|....:||||.||..........   ..|.||:|..|||:
Zfish   333 SRSEVKKPRRTACPYGSSCYRKNPLHFQECSHPGDIDYEEEKADEEENEDDDRPECPYGTQCYRK 397

  Fly   173 NPVHFQDYSHPADFNSAQNIRNRLRQRRAQRQNDDDSGTDEEDEPFGGDNDRDADYRPGADINED 237
            ||:|.::|.|     :....:|......|....|....:...||....:.|.|:||.|.:|.:..
Zfish   398 NPLHKKEYKH-----TKSPPKNTAAAAAADEDEDQYENSFINDESEEEEVDEDSDYVPESDGSGK 457

  Fly   238 ED 239
            ||
Zfish   458 ED 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6171NP_001097801.1 zf-CCHH 122..142 CDD:287283 8/19 (42%)
zf-CCHH 161..182 CDD:287283 11/20 (55%)
aplfNP_001353181.1 FHA 18..102 CDD:238017
Rho 149..>324 CDD:333130 22/120 (18%)
zf-CCHH 345..367 CDD:313506 10/21 (48%)
zf-CCHH 388..409 CDD:313506 11/25 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008022
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108760
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.