DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6171 and aplf

DIOPT Version :9

Sequence 1:NP_001097801.1 Gene:CG6171 / 41872 FlyBaseID:FBgn0026737 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_012818115.1 Gene:aplf / 100127823 XenbaseID:XB-GENE-962442 Length:509 Species:Xenopus tropicalis


Alignment Length:261 Identity:71/261 - (27%)
Similarity:111/261 - (42%) Gaps:79/261 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KSSEDITHNCNANFGAENGLRKRVKSEEPVASIKDETNPEVPMKIKAEPVENADEPTSTTPAIKI 80
            ||::|..:||           ..|:|.:   :||:.||.           .:.:..:::|...:|
 Frog   281 KSNDDDKNNC-----------LDVESNQ---NIKEVTNR-----------YSENRQSNSTSVKQI 320

  Fly    81 KAEPADNGNSPAAAMVKTEPTNSNAQDAADESTVSSS--------SIRTSCRFGIRCYRRNPAHR 137
            ||..:...::...::...|          |||:..::        :.||.|.:|..|||:||||.
 Frog   321 KASTSKTSHNDDLSLSPEE----------DESSEKANFNGGHEAVNRRTPCMYGENCYRKNPAHF 375

  Fly   138 SAEAHPGDQDYRRPNFPAPPLGT-------PACPFGNACYRRNPVHFQDYSHPADFNSAQNIRNR 195
            ....||||:||....     .|:       |.||:|..|||:||.|..:|.|.......   ..|
 Frog   376 EEFCHPGDRDYDNTE-----KGSQDDSDERPECPYGTDCYRKNPQHKLEYKHTKPPGKG---GRR 432

  Fly   196 LRQRRAQRQN---DDDSGT---------------DEEDEPFGGDN-DRDADYRPGADINEDEDDE 241
            ||:|.|::..   ||||..               |:|:|.|  || |.|:|:.|.::..:.||.:
 Frog   433 LRKRPAKKGKSVLDDDSDNDGDPNEYDLEDSFLDDDEEEDF--DNTDEDSDWMPDSEEKDTEDMK 495

  Fly   242 L 242
            |
 Frog   496 L 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6171NP_001097801.1 zf-CCHH 122..142 CDD:287283 9/19 (47%)
zf-CCHH 161..182 CDD:287283 11/20 (55%)
aplfXP_012818115.1 FHA_2 17..99 CDD:375424
zf-CCHH 358..380 CDD:370948 11/21 (52%)
zf-CCHH 400..422 CDD:370948 11/21 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008022
OrthoInspector 1 1.000 - - oto105372
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4471
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.