DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trax and AT2G03780

DIOPT Version :9

Sequence 1:NP_650454.2 Gene:Trax / 41871 FlyBaseID:FBgn0038327 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_178473.2 Gene:AT2G03780 / 814905 AraportID:AT2G03780 Length:287 Species:Arabidopsis thaliana


Alignment Length:264 Identity:82/264 - (31%)
Similarity:134/264 - (50%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AAQLDEDSPIVQQFRIYSNELIMKHDRHERIVKLSRDITIESKRIIFLLHSIDSRKQNKEKVLEE 85
            |..:..:|.:...|..|::.|...:::.||:||:|||||:.||::||.:|.:.  |.|||:|||:
plant    41 ARTMSTESSMKDAFSTYADYLNNFNEKRERVVKVSRDITMNSKKVIFQVHRLS--KDNKEEVLEK 103

  Fly    86 ARQRLNKLIAVNFRAVALELRDQDVYQFRSSYSPGLQEFIEAYTYMEY-----LCHEDAEGENET 145
            |.:.|..:...:|..:..||:..|.::.|.:||||:||::||.|:.::     ||..|   |..|
plant   104 AGKDLEAVRDQHFARLMKELQGTDFWKLRRAYSPGVQEYVEAATFYKFCLSGTLCTLD---EINT 165

  Fly   146 KSVSDWQAIQAVMQYVEESSQPKEEPTEGEDVQAIAQVESPKKFQFFVDPTEYILGLSDLTGELM 210
            ..|              ..|.|..||.:                   ::..:|||||:|||||||
plant   166 TLV--------------PLSDPSLEPLQ-------------------INILDYILGLADLTGELM 197

  Fly   211 RRCINSLGSGDTDTCLDTCKALQHFYSGYISL--NCQRARELWRKITTMKQSVLKAENVCYNVKV 273
            |..|..:..|:.:.....|:.::..:...:.:  ....:.::..|:..|.|||:|.||.|::|.|
plant   198 RMAIGRISDGEIEFAQRICQFVRQIHRELMLVVPKMDDSYDMKSKMEVMLQSVIKIENACFSVHV 262

  Fly   274 RGGE 277
            ||.|
plant   263 RGLE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TraxNP_650454.2 Translin-like 37..267 CDD:271348 72/236 (31%)
AT2G03780NP_178473.2 Translin 66..264 CDD:366871 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 110 1.000 Domainoid score I2100
eggNOG 1 0.900 - - E1_COG2178
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4374
Inparanoid 1 1.050 116 1.000 Inparanoid score I2014
OMA 1 1.010 - - QHG55787
OrthoDB 1 1.010 - - D1213910at2759
OrthoFinder 1 1.000 - - FOG0006191
OrthoInspector 1 1.000 - - oto3474
orthoMCL 1 0.900 - - OOG6_105072
Panther 1 1.100 - - LDO PTHR10741
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4467
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.