DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trax and tsnax

DIOPT Version :9

Sequence 1:NP_650454.2 Gene:Trax / 41871 FlyBaseID:FBgn0038327 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001025275.1 Gene:tsnax / 556657 ZFINID:ZDB-GENE-050913-80 Length:281 Species:Danio rerio


Alignment Length:271 Identity:94/271 - (34%)
Similarity:159/271 - (58%) Gaps:26/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RKRQIPAAQLDED-----SPIVQQFRIYSNELIMKHDRHERIVKLSRDITIESKRIIFLLHSIDS 74
            |||:..|.|..||     |.::..|:::..||..::|::||:||:|||:||||||.|||||.:.|
Zfish    11 RKRRTEAGQRSEDCMNPNSVVISAFKVFQQELDTRYDKYERLVKISRDVTIESKRTIFLLHRVAS 75

  Fly    75 RKQNKEKVLEEARQRLNKLIAVNFRAVALELRDQDVYQFRSSYSPGLQEFIEAYTYMEYLCHEDA 139
             ..:.|::|.||..:|:. :......:|.|||.:|::||..:::||:||::||.::..::.|   
Zfish    76 -VPDVEEILNEAEVKLDG-VRQKIGQIAEELRGEDLHQFHRAFTPGIQEYVEAVSFHHFIRH--- 135

  Fly   140 EGENETKSVSDWQAIQAVMQYVEESSQPKEEPTEGEDVQAIAQVESPKKFQFFVDPTEYILGLSD 204
                  :|:...:.|.|.:.::.::::...|.|          ..||....|.:.||:|:||::|
Zfish   136 ------RSLISLEEINARLVFIRDNNKAVGEGT----------FSSPCVLTFQITPTDYLLGVAD 184

  Fly   205 LTGELMRRCINSLGSGDTDTCLDTCKALQHFYSGYISLNCQRARELWRKITTMKQSVLKAENVCY 269
            |||||||.||:|:|:||.||.......|:..:.|:..:......|:.:|:..::||:.|.|:.||
Zfish   185 LTGELMRMCISSVGNGDMDTPFQLSGFLRQIHDGFSLIGNTGPYEVSKKLHALRQSLGKVEDACY 249

  Fly   270 NVKVRGGEAAK 280
            .::|||.|..|
Zfish   250 TLRVRGSEIPK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TraxNP_650454.2 Translin-like 37..267 CDD:271348 78/229 (34%)
tsnaxNP_001025275.1 Translin 47..255 CDD:280221 79/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574319
Domainoid 1 1.000 149 1.000 Domainoid score I4393
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4374
Inparanoid 1 1.050 168 1.000 Inparanoid score I4135
OMA 1 1.010 - - QHG55787
OrthoDB 1 1.010 - - D1213910at2759
OrthoFinder 1 1.000 - - FOG0006191
OrthoInspector 1 1.000 - - oto40797
orthoMCL 1 0.900 - - OOG6_105072
Panther 1 1.100 - - LDO PTHR10741
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4467
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.