DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trax and tsnax

DIOPT Version :10

Sequence 1:NP_650454.2 Gene:Trax / 41871 FlyBaseID:FBgn0038327 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001006778.1 Gene:tsnax / 448467 XenbaseID:XB-GENE-947707 Length:297 Species:Xenopus tropicalis


Alignment Length:59 Identity:18/59 - (30%)
Similarity:23/59 - (38%) Gaps:13/59 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 AAQQAAAHQ-MQQSQFVNAIANPPCPP----------PPPGIPSMPWPISTPVCHVPYF 296
            ||::|..|. .||.|...:.|..|.|.          ..|||....:  |...|||.:|
 Frog   475 AAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITLTTY--SRSECHVDFF 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TraxNP_650454.2 Translin-like 37..267 CDD:271348 7/18 (39%)
tsnaxNP_001006778.1 Translin 51..272 CDD:460410
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.