DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trax and trsn

DIOPT Version :9

Sequence 1:NP_650454.2 Gene:Trax / 41871 FlyBaseID:FBgn0038327 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_610591.1 Gene:trsn / 36110 FlyBaseID:FBgn0033528 Length:235 Species:Drosophila melanogaster


Alignment Length:283 Identity:60/283 - (21%)
Similarity:95/283 - (33%) Gaps:82/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LDEDSPIVQQFRIYSNELIMKHDRHERIVKLSRDITIESKRIIFLLHS----IDSRKQNKEKVLE 84
            :|.:..:.:..||...|:  :|...|..:||.            ::||    |.:......|.:|
  Fly    17 IDNEQEVRENIRIVVREI--EHLSKEAQIKLQ------------IIHSDLSQISAACGLARKQVE 67

  Fly    85 EARQRLNKLIAVNFRAVALELRDQDVYQFRSSYSPGLQEFIEAYTYMEYLCHEDAEGENETKSVS 149
            ...|:..|                            |.|.:.|..|..|..|             
  Fly    68 LCAQKYQK----------------------------LAELVPAGQYYRYSDH------------- 91

  Fly   150 DWQAIQ-------AVMQYVEESSQPKEEPTEGEDVQAIAQVESPKKFQFFVDPTEYILGLSDLTG 207
             |..|.       |::.|:|.......|.........|:|.|.     |.:|..:|:||:..|..
  Fly    92 -WTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEG-----FHLDVEDYLLGILQLAS 150

  Fly   208 ELMRRCINSLGSGDTDTCLDTCKALQHFYSGYISLNCQRARELWRKITTMKQSVLKAENVCYNVK 272
            ||.|...||:..||.:..|:....:....:|:..||.:. ..|.::...:|..|.|.|.|.|:|.
  Fly   151 ELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLKN-DGLRKRFDALKYDVKKIEEVVYDVS 214

  Fly   273 VRGGEAAKWGATFDQKPADEVDE 295
            :||         ...|..|:.:|
  Fly   215 IRG---------LSSKEKDQQEE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TraxNP_650454.2 Translin-like 37..267 CDD:271348 49/240 (20%)
trsnNP_610591.1 Translin 13..217 CDD:271349 55/261 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10741
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.