| Sequence 1: | NP_524366.1 | Gene: | Cog2 / 41870 | FlyBaseID: | FBgn0026634 | Length: | 710 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_084022.2 | Gene: | Cog2 / 76332 | MGIID: | 1923582 | Length: | 731 | Species: | Mus musculus |
| Alignment Length: | 53 | Identity: | 12/53 - (22%) |
|---|---|---|---|
| Similarity: | 23/53 - (43%) | Gaps: | 15/53 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 STSSSATKTTAVDQDTTELMARFFVSQGIALECAQESPFQELIKHISPNCMVP 69 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cog2 | NP_524366.1 | COG2 | 22..154 | CDD:399271 | 9/48 (19%) |
| COG2_C | 546..672 | CDD:463434 | |||
| Cog2 | NP_084022.2 | COG2 | 15..147 | CDD:399271 | 12/53 (23%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 469..496 | ||||
| COG2_C | 565..692 | CDD:463434 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 659..680 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||