DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cog2 and cog2

DIOPT Version :9

Sequence 1:NP_524366.1 Gene:Cog2 / 41870 FlyBaseID:FBgn0026634 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_595336.1 Gene:cog2 / 2540377 PomBaseID:SPBC36.08c Length:191 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:34/143 - (23%)
Similarity:65/143 - (45%) Gaps:26/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FSVDEFLHKNRNAPSLEQLRDNLGLYLKGLRAAMIDLINEDYADFVNLSANLVGLDQNIKT---- 94
            ||.||||...|.. .|:.|.:.|....:.:...::.|:.::|.|||:|.:.:...:..:.|    
pombe    33 FSPDEFLVSKRFL-GLDGLVNELSRLFEQVNNELMLLVKDNYQDFVHLGSRMKSGNTKVSTLISS 96

  Fly    95 IQQPLEQFRSDIESIHGLIDENVTELRAQLEEKR----------------QLREFKRGLQSLKKV 143
            |.:..||.::..:|:.|    :.||::..|:.|:                |:.:|.:...|...:
pombe    97 IHRSEEQLKNSKQSLIG----HSTEIQNNLKHKQDVENEKLIASNLLLLDQILKFLKSNDSSHPL 157

  Fly   144 Y-ETINKLQDLID 155
            : |::|..|.|.|
pombe   158 WLESLNNAQRLCD 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cog2NP_524366.1 COG2 22..154 CDD:283743 32/140 (23%)
DUF3510 546..672 CDD:288845
cog2NP_595336.1 Dor1 33..142 CDD:302817 26/113 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102642
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.