DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hibch and CDYL

DIOPT Version :10

Sequence 1:NP_732020.2 Gene:Hibch / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001355054.1 Gene:CDYL / 9425 HGNCID:1811 Length:598 Species:Homo sapiens


Alignment Length:64 Identity:17/64 - (26%)
Similarity:26/64 - (40%) Gaps:23/64 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 CQHAFAFPACGMET-------GFFPGTCPEMT---------CSSQDVNISET-----CGEVPYS 247
            ||.:.|.|...:||       ....|:.|:.|         |  ::|::.||     .|:||.|
Human   600 CQFSQAGPTSMLETEEPCAVENLPGGSLPDSTRQQESKGNVC--EEVSLGETLMESLSGDVPVS 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HibchNP_732020.2 ECH_2 56..375 CDD:465024 17/64 (27%)
CDYLNP_001355054.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76
Interaction with EZH2. /evidence=ECO:0000269|PubMed:22009739 61..309
CD_CDY 62..111 CDD:349284
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..226
crotonase-like 344..540 CDD:119339
Acetyl-CoA-binding domain. /evidence=ECO:0000255 362..594
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.