DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and Cdyl2

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_083717.1 Gene:Cdyl2 / 75796 MGIID:1923046 Length:503 Species:Mus musculus


Alignment Length:318 Identity:59/318 - (18%)
Similarity:118/318 - (37%) Gaps:65/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQGPIQRLV-----YTFGHRTCSQLPMIGGATISQTKPTTMALSVRQSSSS------VLATESSN 54
            :..|::|.:     |.|..|                    :..||||:.|:      |:..|...
Mouse   213 LHSPVKRKLETEKDYVFDKR--------------------LRYSVRQNESNCRFRDIVVRKEEGF 257

  Fly    55 KGMIILNRPKALNAINLEMVRKIYKHLKKCEKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDES 119
            ..:::.::....||:..|:::::.:.|.......|.:::.......||:|.|...|:....:|..
Mouse   258 THILLSSQTSDNNALTPEIMKEVRRALCNAATDDSKLLLLSAVGSVFCSGLDYSYLIGRLSSDRR 322

  Fly   120 KSFFREEYSTNALIG---NYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFP 181
            |...|...:....:.   .:|.|.:..|:|..:|.|..:........||::..|..|...|.|.|
Mouse   323 KESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTP 387

  Fly   182 DVGGSYFLPRLQGKLGLYLG----LTGYRLRGADVYYSGIA------THYCESSKIPDLETALLN 236
            ....||..|::   ||:.|.    ..|.:|...:....|:.      |.:.:...:...|.|..:
Mouse   388 AGCSSYTFPQI---LGVALANEMLFCGRKLTAQEACSRGLVSQVFWPTTFSQEVMLRVKEMASCS 449

  Fly   237 CPDADDVPELLQKYHSPPEKPFSLQPVLEQINKN---------FSADSVEGILENLQN 285
            ....::...|::.:         |:.|||::|:.         .|:..::.:...||:
Mouse   450 AVVLEESKCLVRSF---------LKSVLEEVNEKECVMLKQLWSSSKGLDSLFSYLQD 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 50/270 (19%)
ECH_2 56..374 CDD:292731 47/252 (19%)
Cdyl2NP_083717.1 CHROMO 7..55 CDD:214605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..177
crotonase-like 249..445 CDD:119339 38/198 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.