DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and Ehhadh

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_076226.2 Gene:Ehhadh / 74147 MGIID:1277964 Length:718 Species:Mus musculus


Alignment Length:212 Identity:55/212 - (25%)
Similarity:98/212 - (46%) Gaps:27/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MIILNRPKALNAINLEMVRKIYKHLKKCEKSKSL--VIIKGTGDKAFCAGGDVRALVEAGPTDES 119
            ||.|..| .:|||:..::.::...|:|.....::  ::|.|..|. ||||.|:...  ..||..:
Mouse    13 MIRLCNP-PVNAISPTVITEVRNGLQKASLDHTVRAIVICGANDN-FCAGADIHGF--KSPTGLT 73

  Fly   120 KSFFREEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVG 184
            .....:|      |..|:.|.:|.|.|:.:|||:.|::...||:|:.:.....||..:|:.|...
Mouse    74 LGSLVDE------IQRYQKPVVAAIQGVALGGGLELALGCHYRIANAKARVGFPEVMLGILPGAR 132

  Fly   185 GSYFLPRLQGKLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDADDVPELLQK 249
            |:..|||:   :|:.:.|        |:..||......|:.|:..|:..:    .:|.|.|.::.
Mouse   133 GTQLLPRV---VGVPVAL--------DLITSGRHISTDEALKLGILDVVV----KSDPVEEAIKF 182

  Fly   250 YHSPPEKPFSLQPVLEQ 266
            ..:...||...:.:|.:
Mouse   183 AQTVIGKPIEPRRILNK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 55/212 (26%)
ECH_2 56..374 CDD:292731 55/212 (26%)
EhhadhNP_076226.2 Enoyl-CoA hydratase / isomerase 1..280 55/212 (26%)
crotonase-like 12..186 CDD:119339 52/197 (26%)
fadJ 20..702 CDD:236864 51/204 (25%)
3-hydroxyacyl-CoA dehydrogenase 281..567
3HCDH_N 297..471 CDD:280833
3HCDH 473..577 CDD:279114
3HCDH 614..700 CDD:279114
Microbody targeting signal. /evidence=ECO:0000250 716..718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.