DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and cdyl

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_696879.5 Gene:cdyl / 568457 ZFINID:ZDB-GENE-070912-561 Length:581 Species:Danio rerio


Alignment Length:281 Identity:53/281 - (18%)
Similarity:105/281 - (37%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MALSVRQSSSS------VLATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEKSKS-LVII 93
            :..||||:.|:      |:..:.....::...:....|::|.::::::...:.......| ||::
Zfish   311 LRFSVRQTESAYRYRDIVVKKQDGFTHILFSTKTSENNSLNPDVMKEVQSAMATAAADDSKLVLL 375

  Fly    94 KGTGDKAFCAGGDVRALVEAGPTDESKSFFREEYSTNALIG---NYKIPYIAIIDGITMGGGVGL 155
            .|.| ..||.|.|....:.....|..|...:...:....:.   .:|.|.||.::|..:|.|..:
Zfish   376 SGVG-SVFCFGLDFIYFIRRLTDDRKKESIKMAETIRTFVNTFIQFKKPIIAAVNGPAIGLGASI 439

  Fly   156 SVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGL-YLGLTGYRLRGADVYYSGIAT 219
            ........|:::..|..|.|..|..||...|...|.:.|.... .:.|:|.:|...:....|:.:
Zfish   440 LPLCDVIWANEKAWFQTPYTTFGQTPDACSSVTFPLIMGVASANEMLLSGRKLTAQEACAKGLVS 504

  Fly   220 H------YCESSKIPDLETALLNCPDADDVPELLQKYHSPPEKPFSLQPVLEQINKN-------- 270
            .      :.:...:...|....|.....:...|::..:         :..|||.|:.        
Zfish   505 QVLWPGTFTQEVMVRIKELVSCNSVVLRESKALVRNIN---------RAALEQANERECEALKRV 560

  Fly   271 -FSADSVEGILENLQNDGSEW 290
             .|:..::.||:.||....|:
Zfish   561 WGSSQGMDSILKYLQKKIDEF 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 49/273 (18%)
ECH_2 56..374 CDD:292731 47/255 (18%)
cdylXP_696879.5 CHROMO 8..61 CDD:214605
crotonase-like 327..523 CDD:119339 35/196 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.