DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and ECHDC1

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001132982.1 Gene:ECHDC1 / 55862 HGNCID:21489 Length:307 Species:Homo sapiens


Alignment Length:313 Identity:69/313 - (22%)
Similarity:126/313 - (40%) Gaps:63/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VYTFGH--------RTCSQLPMIGGATISQTKPTTMALSVRQSSSSVLATESSNKGMIILNRPKA 65
            :|:..|        :|..|.|  ||                   |..|..|.:..|::.||.|..
Human    31 LYSTSHGFYEEEVKKTLQQFP--GG-------------------SIDLQKEDNGIGILTLNNPSR 74

  Fly    66 LNAIN----LEMVRKIYKHLKKCEKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDESKSFFREE 126
            :||.:    |:::.|:.: |:...:.|.| |::| ....|.:|.|:.|:...|..::..:...  
Human    75 MNAFSGVMMLQLLEKVIE-LENWTEGKGL-IVRG-AKNTFSSGSDLNAVKSLGTPEDGMAVCM-- 134

  Fly   127 YSTNALIGNYKIPYI--AIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFL 189
            :..|.|....::|.|  |::.|..:|||...:....:|:.:..:........:|:.|..||:..|
Human   135 FMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRL 199

  Fly   190 PRLQGKLGLYLGLTG-YRLRGADVYYSGIATHYCESSKIPDLETALLNCPDADDVPELLQKY-HS 252
            ..:.|.......|:| .:|...:....|:.....:||.    ||..|     ::..|.|::: ..
Human   200 VEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSD----ETKSL-----EEAQEWLKQFIQG 255

  Fly   253 PPEKPFSLQPVLEQINKNFSADSVEGILENLQND----GSEW-AKKTLETLSK 300
            |||       |:..:.|:..:.....:.|.|||:    |:.| ....||.::|
Human   256 PPE-------VIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 62/270 (23%)
ECH_2 56..374 CDD:292731 59/258 (23%)
ECHDC1NP_001132982.1 crotonase-like 60..251 CDD:119339 46/204 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.