DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and ECHDC2

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_011540011.1 Gene:ECHDC2 / 55268 HGNCID:23408 Length:318 Species:Homo sapiens


Alignment Length:224 Identity:61/224 - (27%)
Similarity:96/224 - (42%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RTCSQLPMIGGATISQTKPTTMALSVRQSSSSVLATESSNKGM--IILNRPKALNAINLEMVRKI 77
            |.|:.....||:.|                 .|.|....::|:  |::|||.|.||:....|.::
Human    17 RGCASDGAAGGSEI-----------------QVRALAGPDQGITEILMNRPSARNALGNVFVSEL 64

  Fly    78 YKHLKKCEKSKSL-VIIKGTGDK-AFCAGGDVRALVEAGPTDESKSFFREEYSTNAL-------- 132
            .:.|.:..:.:.: |::..:|.| .||||.|::.              ||:.|...:        
Human    65 LETLAQLREDRQVRVLLFRSGVKGVFCAGADLKE--------------REQMSEAEVGVFVQRLR 115

  Fly   133 -----IGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRL 192
                 |..:..|.||.:||..:|||:.|::....|||:...:..:.||..||.|..||:..|||.
Human   116 GLMNDIAAFPAPTIAAMDGFALGGGLELALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRC 180

  Fly   193 QG-KLGLYLGLTGYRLRGADVYYSGIATH 220
            .| .|...|..||.||.|.:.:..|:..|
Human   181 LGVALAKELIFTGRRLSGTEAHVLGLVNH 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 56/195 (29%)
ECH_2 56..374 CDD:292731 54/183 (30%)
ECHDC2XP_011540011.1 crotonase-like 38..252 CDD:304874 54/186 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.