DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and auh

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001003576.2 Gene:auh / 445182 ZFINID:ZDB-GENE-040801-95 Length:325 Species:Danio rerio


Alignment Length:291 Identity:73/291 - (25%)
Similarity:124/291 - (42%) Gaps:57/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RTC--SQLPMI-----GGATISQTKPTTMALSVRQSSSSVLA--------TESSNKGMII--LNR 62
            :||  .:||.:     ||              ||..||.|.:        .:..:.|:::  :||
Zfish    32 QTCLPKRLPCVHRAFSGG--------------VRLYSSEVNSGDDLIVRYLDGDDSGIVVMGINR 82

  Fly    63 PKALNAINLEMVRKIYKHLK--KCEKSKSLVIIKGTGDKAFCAGGDVRALV-----EAGP-TDES 119
            |:|.|||:..:|..:.:.|:  |.:.:...||:.......||||.|::...     |.|| ..::
Zfish    83 PEAKNAISKNLVSMMSEALESMKTDNTVRTVILCSMVPGIFCAGADLKERAKMQQSEVGPFVTKA 147

  Fly   120 KSFFREEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVG 184
            ::...|       :|...:|.||.|||..:|||:.:::....|||::.....:.||.:.:.|..|
Zfish   148 RTLISE-------LGALPMPTIAAIDGAALGGGLEMALACDIRVAANSAKMGLVETKLAIIPGAG 205

  Fly   185 GSYFLPRLQG-KLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDADDVPELLQ 248
            |:..|||..| .:...|......|.|.:....|:..|..|.:|..|  .|.|...|      |.:
Zfish   206 GTQRLPRTVGVSIAKELIFAARVLNGEEAKSLGLVNHAVEQNKGGD--AAYLRALD------LAR 262

  Fly   249 KYHSPPEKPFSLQPVLEQINKNFSADSVEGI 279
            ::  .|:.|.:::.....||:....|...|:
Zfish   263 EF--IPQGPIAVRMAKLAINQGIEVDLKTGL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 65/255 (25%)
ECH_2 56..374 CDD:292731 62/235 (26%)
auhNP_001003576.2 crotonase-like 71..325 CDD:304874 62/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.