DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and HIPP1

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster


Alignment Length:350 Identity:77/350 - (22%)
Similarity:117/350 - (33%) Gaps:124/350 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 TESSNKG------MIILNRPKALNAINLEMVRKIYK--HL------------------------- 81
            ::||.:|      ..:.|..||.|...|..:.|:.|  ||                         
  Fly   643 SKSSQRGGEDTSSHTLANDMKANNGSELVCLHKVNKVAHLVIHTERGNFGHTYSKQLLEQLNDTL 707

  Fly    82 ----KKCEKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDESKSFFREEYSTNAL---------- 132
                :|.|.:..|:.::|   ..||.|.|.:.|:: |..::.|.      |.:.|          
  Fly   708 SSVARKGEFNTVLLTVEG---PQFCQGIDCQELIQ-GSLEKRKD------SASQLAVALKCYLRT 762

  Fly   133 IGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFL----PRLQ 193
            :..:..|.:|.|.|..:..||.......|.||||...|......:|..|:   .|.|    .|:.
  Fly   763 LATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPE---GYALWHGHQRVS 824

  Fly   194 GKLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDADDVPEL-LQKYHSPPEKP 257
            .::...|.|.|.||         .||...||:...|      ....|.:|.|: |.|        
  Fly   825 SEVHSRLFLMGERL---------FATELLESNSFVD------KICKARNVNEMALAK-------- 866

  Fly   258 FSLQPVLEQINKNFSADSVEGILENLQNDGSEWAKKTLETLSKMSPTSMKVT-FRQLE-----LG 316
                      .|..|..|.|                ...||.|::.:::.|| |.:|:     :|
  Fly   867 ----------AKQISTSSAE----------------MYRTLKKLNHSAVNVTKFPRLDEELKVIG 905

  Fly   317 SQLSLAQCLIMEYRLAVRHLERSDF 341
            .|...|.|| ..::   |:|...||
  Fly   906 EQWVTADCL-ANFK---RYLNDVDF 926

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 76/349 (22%)
ECH_2 56..374 CDD:292731 74/343 (22%)
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339 50/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451175
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.