DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and Dci

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster


Alignment Length:264 Identity:65/264 - (24%)
Similarity:116/264 - (43%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LATESSNKGMII-LNRPKALNAINLEMVRKIYKHLKKC------EKSKSLVIIKGTGDKAFCAGG 105
            |..|...|.::. .|.||..|.||    |..|:.:.:.      ::..::|:..|.|| .|.:|.
  Fly     9 LLVEQQGKLLVAKFNNPKKKNCIN----RVAYQEMTRVLTEVNDDEGVTIVVFTGVGD-IFTSGN 68

  Fly   106 DVRALVEAGPTDESKSFFREEYST-NALIGNY----KIPYIAIIDGITMGGGVGLSVHGKYRVA- 164
            |   |.::..||:..:||::..:| .|::.::    || .:|:::|..:  |:|.::.|...|| 
  Fly    69 D---LSQSSNTDDIDAFFKQSNATFKAMVLSFVNCRKI-VLALVNGPAI--GIGATIVGLCDVAW 127

  Fly   165 -SDRTLFAMPETAIGLFPDVGGSYFLPRLQGK-LGLYLGLTGYRLRGADVYYSGIATHYCESSKI 227
             |:.|.|..|.|.:||.|:.|.||.||.:.|: ....:.|....|...:.|.....:...::|  
  Fly   128 CSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKAS-- 190

  Fly   228 PDLETALLNCPDADDVPELLQKYHSPPEKPFSLQPVLEQINKNFSADSVEGILENLQNDGSEWAK 292
             :||:.:.        |:|.|....|.......:.:::           :|.||||........|
  Fly   191 -ELESVIW--------PKLRQYSELPTNSLLQGKRLVK-----------DGFLENLIKANEAECK 235

  Fly   293 KTLE 296
            :.|:
  Fly   236 QLLQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 65/264 (25%)
ECH_2 56..374 CDD:292731 62/256 (24%)
DciNP_612065.1 crotonase-like 9..197 CDD:119339 54/201 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451173
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.