DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and CG6984

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_611187.1 Gene:CG6984 / 36926 FlyBaseID:FBgn0034191 Length:285 Species:Drosophila melanogaster


Alignment Length:263 Identity:61/263 - (23%)
Similarity:112/263 - (42%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SSSVLATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEKSKSL--VIIKGTGDKAFCAGGD 106
            |..||..|.:....|.||.||.||:::|:|:..:...|.|.:.:..|  |::...| |.:.||.:
  Fly    31 SDLVLVKEHNGVREITLNHPKTLNSLSLDMMCALQDALLKDKDNLDLRCVVLTAQG-KIWSAGHN 94

  Fly   107 VRALVEAGPTDESKSFFREEYSTNAL--IGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTL 169
            ::.| ...|..::..|   :..|:.:  |....:|.:..::|.....|..|.|.....|.:..:.
  Fly    95 LKEL-HNDPKIQACVF---QKLTDVINDIQRLPVPVLGKVNGYAAAAGCQLVVSCDMVVCTKNSK 155

  Fly   170 FAMPETAIGLF---PDVGGSYFLPRLQGKLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLE 231
            |:.|...:|:|   |.|..:..:.|.:   ..|:.:||..:.|.:.|.||:.|....:.::....
  Fly   156 FSTPGAGVGVFCSTPGVAVARIMSRPK---SAYMLMTGLPVTGEEAYISGMVTKAVPAEELDKEI 217

  Fly   232 TALLNCPDADD--VPELLQKYH------SPPEKPFSLQPVLEQINKNFS-ADSVEGILENLQNDG 287
            ..:.|...|..  |..|.::::      |..|   :.....|::.:||. .|:.|||....:...
  Fly   218 EEITNAIKAKSRAVISLGKEFYYKQLAMSQAE---AFSAAQEKMCENFQLGDTKEGIASFFEKRP 279

  Fly   288 SEW 290
            ..|
  Fly   280 PNW 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 61/263 (23%)
ECH_2 56..374 CDD:292731 57/251 (23%)
CG6984NP_611187.1 crotonase-like 24..283 CDD:304874 61/263 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.