DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and echs1

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001004529.1 Gene:echs1 / 368912 ZFINID:ZDB-GENE-030616-617 Length:291 Species:Danio rerio


Alignment Length:336 Identity:89/336 - (26%)
Similarity:132/336 - (39%) Gaps:84/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SQTKPTTMALSVRQSSSSV--------LATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCE 85
            |:..|:.:| :.|||||.|        ...|..|.|.|.|||||||||:...::.::.|.|...|
Zfish    15 SKLLPSALA-ATRQSSSGVQYEYILVDKKGEKKNVGFIQLNRPKALNALCDGLMLEVGKALDAFE 78

  Fly    86 KSKSLVIIKGTG-DKAFCAGGDVRALVEAGPTDESKSFFREEYSTNAL-----IGNYKIPYIAII 144
            ....:..|..|| :|||.||.|::.:        ....|:|.|..|.|     :...|.|.||.:
Zfish    79 MDSEVGAIVVTGSEKAFAAGADIKEM--------QNRTFQECYGGNFLAHWNRVSTVKKPVIAAV 135

  Fly   145 DGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGK-LGLYLGLTGYRLR 208
            :|..:|||...::......|.::..|..||..:|..|..||:..|.|..|| |.:.:.|||.|:.
Zfish   136 NGFALGGGCEFAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRIS 200

  Fly   209 GADVYYSGIATHYCESSKIPDLETALLNCPDADDVPELLQKYHSPPEKPFSLQPVLEQINKNFSA 273
            ..:...||:.      |||         .|....|||.::                       ..
Zfish   201 AQEAKQSGLV------SKI---------FPVDQLVPEAIK-----------------------CG 227

  Fly   274 DSVEGILENLQNDGSEWAKKTLETLSKMSPTSMKVTFRQLELGSQLSLAQCLIMEYRLAVRHLER 338
            :.:.|               ..:.:|.|:..|:...|       :|:||:....|.||.......
Zfish   228 EKIAG---------------NSKLVSAMAKESVNAAF-------ELTLAEGSRFEKRLFHATFAT 270

  Fly   339 SDFKEGVRALL 349
            .|.|||:.|.:
Zfish   271 EDRKEGMSAFV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 83/321 (26%)
ECH_2 56..374 CDD:292731 78/301 (26%)
echs1NP_001004529.1 crotonase-like 34..291 CDD:304874 80/316 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.