DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and Echs1

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster


Alignment Length:279 Identity:79/279 - (28%)
Similarity:128/279 - (45%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LSVRQSSSSV----------LATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEKSKSLVI 92
            ::.|.||||.          :|.|..|.|:|.|||||||||:...:::::...|::..|.|::..
  Fly    25 VATRFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISA 89

  Fly    93 IKGTG-DKAFCAGGDVRALVEAGPTDESKSFFREEYSTNALIGNY----------KIPYIAIIDG 146
            |..|| :|||.||.|::.:|  |.|          || ..:.||:          :.|.||.::|
  Fly    90 IVLTGSEKAFAAGADIKEMV--GNT----------YS-QCIQGNFLNDWTEVARTQKPIIAAVNG 141

  Fly   147 ITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGK-LGLYLGLTGYRLRGA 210
            ..:|||..|::......|.|:..|..||.|:|..|..||:..|.|:.|| ..:.:.|||..:...
  Fly   142 YALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQ 206

  Fly   211 DVYYSGIATHYCESSKIPDLETALLNCPDADDVPELLQKYHSPPEKPFSLQPVLEQINKNFSADS 275
            :....|:|     |..:|           ||   :||.:.....||..:...::.|:.|    ::
  Fly   207 EAEKLGLA-----SKVVP-----------AD---QLLGEAVKLGEKIGTHSNLIVQLCK----EA 248

  Fly   276 VEGILENLQNDGSEWAKKT 294
            |....|....:|.::.::|
  Fly   249 VNTAYETTLQEGLKFERRT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 77/273 (28%)
ECH_2 56..374 CDD:292731 71/251 (28%)
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 74/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451190
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.