DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and CG4592

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001260306.1 Gene:CG4592 / 34317 FlyBaseID:FBgn0032162 Length:287 Species:Drosophila melanogaster


Alignment Length:292 Identity:68/292 - (23%)
Similarity:115/292 - (39%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MIGGATISQTKPTTMALSVRQSSSSVLATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEK 86
            :..|||   :|.||:.:..|    |.:||.|       :|.| .:|.:.:|::..:...:.:.|.
  Fly    26 LANGAT---SKLTTIEVDDR----SGIATLS-------MNLP-PVNTLTMELMHDLIDSINQIES 75

  Fly    87 SKSL-VIIKGTGDKAFCAGGDVRALVEAGPTDESKSF---FREEYSTNALIGNYKIPYIAIIDGI 147
            :||. :|:..:.||.|.||.|:..::.. ..:..:.|   |::.:....|.|   :|..|.|:|.
  Fly    76 NKSRGLILTSSNDKVFSAGLDLNEMLNP-DVERLRLFWTRFQDLWLALHLCG---LPTAAAINGH 136

  Fly   148 TMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPD---------VGGSY--FLPRL-------QG 194
            :...|..|:...:|||       .:|...||:...         :..||  .|||.       ||
  Fly   137 SPAAGCVLATACEYRV-------MLPNLFIGIHATRFSFVISKWMMNSYQSVLPRRIVERALNQG 194

  Fly   195 KL-----GLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLN--CPDADDVPELLQKYHS 252
            ||     .|.:||........:...|..|.......|...:...|..  |.: .||.||||    
  Fly   195 KLFASQEALDVGLVDEIACSKEEALSKCAAFIATFDKTNPVARCLTKRMCRE-PDVRELLQ---- 254

  Fly   253 PPEKPFSLQPVLEQINKNFSADSVEGILENLQ 284
              ::...|:..::.:......:.:...||.|:
  Fly   255 --DRAADLKECVDYVTTPLFQEGLCAHLEGLK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 61/270 (23%)
ECH_2 56..374 CDD:292731 57/258 (22%)
CG4592NP_001260306.1 crotonase-like 43..284 CDD:304874 60/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451152
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.