DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and CG4594

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001260305.1 Gene:CG4594 / 34316 FlyBaseID:FBgn0032161 Length:280 Species:Drosophila melanogaster


Alignment Length:296 Identity:67/296 - (22%)
Similarity:109/296 - (36%) Gaps:61/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MIGGATISQTKPTTMALSVRQSSSSVLATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEK 86
            |..||........|...:|..:..:.:||       :.:||| .:|:.|::::..:...:.:.|.
  Fly    10 MAHGAPSRLMSTATKLTTVEINDKTGIAT-------LTMNRP-PVNSQNVQLLLDLQTSISEIEN 66

  Fly    87 SKSL-VIIKGTGDKAFCAGGDVRALVEAGPTDESKSFFREEYS--TNALIGNY--KIPYIAIIDG 146
            :||. :|:.......|.||.|:   .|...||..:  .|..::  .|..|..|  .:|..|.|:|
  Fly    67 NKSRGLILTSASSNVFSAGLDI---FEMYNTDVER--LRTVWTELQNVWIALYGTTLPTAAAING 126

  Fly   147 ITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPD----VGGSYFLPRLQGKLGLYLGLTGYRL 207
            ....||..|:...:|||.....|..:.|..:|:...    .|.:..||:...:..|   ..|...
  Fly   127 HAPAGGCLLATACEYRVMRPNFLIGLNEAQLGIIAPKWLMSGFASILPKRVAERAL---TQGRMF 188

  Fly   208 RGADVYYSGIATHYCESSKIPDLETALLNC-----------PDADDVPELLQKYHSPPEKPFSLQ 261
            ...:.:..|:......|.     |.||..|           |.|..:.:|  ::.....|.|   
  Fly   189 TTQEAFEVGLIDEIASSK-----EEALEKCAAFIGTFAKVNPLARGLTKL--QFRGDNIKEF--- 243

  Fly   262 PVLEQINKNFSAD-----SVEGI-------LENLQN 285
               |.|.:...||     |..|:       ||||:|
  Fly   244 ---EMIREKDIADFVALASSPGVQKVMGAYLENLKN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 62/274 (23%)
ECH_2 56..374 CDD:292731 60/262 (23%)
CG4594NP_001260305.1 crotonase-like 35..275 CDD:304874 60/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451153
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.