DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and echdc2

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_997953.1 Gene:echdc2 / 338247 ZFINID:ZDB-GENE-030219-147 Length:301 Species:Danio rerio


Alignment Length:295 Identity:72/295 - (24%)
Similarity:120/295 - (40%) Gaps:50/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GPIQRLV----YTFGHRTCSQLPMIGGATISQTKPTTMALSVRQSSSSVLATESSNKGM--IILN 61
            |||:||:    :|.....||.      .::|..|      .||.:     ..|..:.|:  :::.
Zfish    10 GPIKRLLPRGSFTQTRSWCSH------GSVSDKK------EVRLN-----RLEGDDNGIVEVLMC 57

  Fly    62 RPKALNAIN---LEMVRKIYKHLKKCEKSKSLV---IIKGTGDKAFCAGGDVRALVEAGPTDESK 120
            |.:|.|::.   :..:|.:...|:.....:.||   :|.|    .||||.|::...:.. ..|::
Zfish    58 RERARNSLGHVFVGQMRDLVSSLQHDSAVRVLVFRSLIPG----VFCAGADLKERAQMS-NAEAE 117

  Fly   121 SFFREEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGG 185
            .|.....|....|....:|.||.:||..:|||:.|::....|.|:......:.||..||.|..||
Zfish   118 LFVHGLRSLMNDIAALPMPTIAAVDGFALGGGLELALACDLRTAAHCAQMGLIETTRGLLPGAGG 182

  Fly   186 SYFLPRLQG-KLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDADDVPELLQK 249
            |..|||..| .:...|..||.|:.|......|:.     :..:|..:|.     ||.....|...
Zfish   183 SQRLPRTVGFAVAKELIFTGRRVGGEQAVNLGLV-----NRSVPQNQTG-----DAAHREALSLA 237

  Fly   250 YHSPPEKPFSLQPVLEQINKNFSAD-----SVEGI 279
            ....|:.|.:::.....:|:....|     ::||:
Zfish   238 REILPQAPIAVRMAKVAMNRGAEVDISSGMAIEGM 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 60/250 (24%)
ECH_2 56..374 CDD:292731 59/238 (25%)
echdc2NP_997953.1 crotonase-like 47..301 CDD:304874 59/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.