DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and eci1

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001292513.1 Gene:eci1 / 334101 ZFINID:ZDB-GENE-030131-6033 Length:301 Species:Danio rerio


Alignment Length:254 Identity:61/254 - (24%)
Similarity:110/254 - (43%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SSSSVLATESSNKGMIILN-RPKALNAINLEMVRKIYKHLKKCEKSKSL--VIIKGTGDKAFCAG 104
            :||.:.....|:.|:.:|. :...:|:::|:.:.:...:|:|.|..:|.  |||.....|.|.||
Zfish    42 TSSKIKVDLDSSNGVAVLQFQSPPVNSLSLDFLTEFAINLEKLELDRSCRGVIITSAQPKVFSAG 106

  Fly   105 GDVRALVEAGPTDESKSFFREEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASD--R 167
            .|:..:.:..|...::.:...:.:...|.|:.|:. ||.|:|.:..||..|::...||:.:|  |
Zfish   107 LDILEMYQKSPEHCAEFWKAVQEAWLKLYGSSKVT-IAAINGNSPAGGCLLAMCCDYRIMADNPR 170

  Fly   168 TLFAMPETAIGL-----FPD-----VGGSYFLPRLQGKLGLYLGLTGYRLRGADVYYSGIATHYC 222
            ....:.||.:|:     |.|     ||      ..:.:.||.|||. |....|  ...|:.....
Zfish   171 YSIGLNETQLGIVAPFWFKDTMLNVVG------HRETEKGLQLGLL-YNTPNA--LKIGLVDELV 226

  Fly   223 ESSKIPDLETALLNCPDADDVPELLQKYHSPPE------KPFSLQPVLEQINKNFSADS 275
            ...|:  |.||          .|.:.|:.:.|:      |....:|.::::..|..||:
Zfish   227 PEDKV--LSTA----------AETMTKWLAIPDHARQISKSMMRKPTVDKLLANREADT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 61/253 (24%)
ECH_2 56..374 CDD:292731 58/241 (24%)
eci1NP_001292513.1 crotonase-like 53..297 CDD:304874 58/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.